KEGG   Lactobacillus johnsonii NCC 533: LJ_0225
Entry
LJ_0225           CDS       T00158                                 

Definition
(GenBank) UDP-N-acetylglucosamine 1-carboxyvinyltransferase 1
  KO
K00790  UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
ljo  Lactobacillus johnsonii NCC 533
Pathway
ljo00520  Amino sugar and nucleotide sugar metabolism
ljo00550  Peptidoglycan biosynthesis
ljo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ljo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    LJ_0225
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    LJ_0225
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:ljo01011]
    LJ_0225
Enzymes [BR:ljo01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.7  UDP-N-acetylglucosamine 1-carboxyvinyltransferase
     LJ_0225
Peptidoglycan biosynthesis and degradation proteins [BR:ljo01011]
 Precursor biosynthesis
  Transferase/Dehydrogenase
   LJ_0225
SSDB
Motif
Pfam: EPSP_synthase
Other DBs
NCBI-ProteinID: AAS08206
UniProt: Q74LG1
LinkDB
Position
259714..260979
AA seq 421 aa
MKQMIIHGGKPLKGDVWIGGAKNSTVALIPASILSRTPVTLEGVPRIADVDNLMDLLSEM
DVKCDFHETTLRINPDNIKRSPLPAGKIKSLRASYYFMGALLGRFGKAVVGFPGGDDIGP
RPIDQHIKGFEALGATVENKNDQIIITAPKTGLRGAKIHLKMPSVGATMNIIMASVMAKG
QTIIENAAKEPEIIDLATFLNNMGAVIRGAGTEVIRIEGVEELKAQTPHTIIPDRIEAGT
YVALAACIGNGIRIHNIIEEHLDSYLAKVEEMGVVIDADEDSLYVYPAGDLKMIQVRTDV
YPGFATDLQQPITPLLLTAKSGEGVVIDQIYPKRVGHIPELQKMGANIQVEDNIILVHPT
HHLHGAHVSAGEIRAGACLMLAGLMADGETIISNAGNILRGYDRIEQKLRQLGAEVSVID
V
NT seq 1266 nt   +upstreamnt  +downstreamnt
atgaaacagatgattattcatggtggaaagcccctgaagggcgacgtatggatcggcggt
gctaagaattccactgtagcattgattccagcgtcaatactttcgcggactcctgttacc
ctagaaggggttccgcgaattgctgatgtagataatttgatggatctacttagtgaaatg
gatgtaaagtgtgattttcatgaaactactttacgaataaatccggataacattaagcgt
agtccccttccagcaggaaagattaagagcttgagagcttcttactactttatgggtgca
ttattaggtcgctttggtaaagctgtggtgggctttccaggcggagatgatattggccct
cgtcctattgatcagcatattaaaggctttgaagcattaggtgcaactgttgagaataaa
aacgatcaaattatcattacagctcctaaaactgggcttcgtggtgcaaaaattcattta
aagatgccttctgtaggcgcaacgatgaatataattatggctagtgtaatggcaaagggc
caaactattattgaaaatgctgctaaggaaccggaaattattgatttagctacatttttg
aataatatgggcgccgttattcgtggtgcaggtactgaagtgattcgaattgaaggagta
gaggaattaaaagcacaaactcctcatactattattcctgatcgaattgaggctggaaca
tatgtagctctagctgcttgcatcggaaatggtattagaattcataatattatcgaagaa
cacctagattcttacttggctaaagtagaagaaatgggtgtagtaattgatgctgatgaa
gattcactttatgtttatccagcaggtgacttgaaaatgattcaagttagaactgatgta
tatcctggatttgcgactgatttacagcagccaattactccacttcttctaacagctaag
agcggtgaaggcgtagtaattgatcaaatatatcctaagcgtgttggtcatattcctgaa
cttcagaagatgggtgcaaatattcaggtagaagataatattatcttagttcatccaact
catcatttgcatggagcacatgttagtgctggtgaaattagagcaggcgcttgtttgatg
cttgctggcttaatggcagatggtgaaactatcatttcaaatgcaggaaacattttgcgt
ggctatgatagaattgaacaaaagttgcgtcaactaggtgcagaggtatctgtgattgat
gtttaa

DBGET integrated database retrieval system