KEGG   Lactobacillus johnsonii NCC 533: LJ_0242Help
Entry
LJ_0242           CDS       T00158                                 

Definition
(GenBank) hypothetical protein
Organism
ljo  Lactobacillus johnsonii NCC 533
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TetR_N
Motif
Other DBs
NCBI-ProteinID: AAS08224
UniProt: Q74LE3
LinkDB All DBs
Position
complement(274790..275323)
Genome map
AA seq 177 aa AA seqDB search
MTTEEKIINQTVHLIDTNGYQNLSLRKLTKELGLTTGAFYRHFKDKNELFQKVVIQLSKR
FIEQIPLNEDYSSKQQLLIIAKYICQSITMHPNQMDFLFYQLSALDLYSNANQYPFLNKV
KNLITNLNSSTTLSDQDLFIQIWSFIQGYALLIKNKITRYDAQLVEYTLNQLLKGKD
NT seq 534 nt NT seq  +upstreamnt  +downstreamnt
atgacaaccgaagaaaaaattataaatcaaaccgttcatctaatcgacactaatgggtat
caaaacttaagtttacgcaaacttacaaaggaactgggacttacaacaggggctttttat
agacatttcaaagataaaaatgaactatttcaaaaagtagtaatccaattatctaaacga
tttattgagcagatcccattaaatgaagattattcatctaaacaacagttactcattatc
gctaaatatatttgtcagtctataactatgcatcccaaccaaatggacttcttattctac
caattatcagcactagatttatattcaaatgctaatcaatatccctttttgaacaaagta
aaaaacttaattactaatcttaattcatcaactactctttctgatcaagatttatttatt
caaatctggtcctttattcaaggatatgcattactaattaaaaataaaattactcgctat
gacgcacaattagtggaatacactttaaatcaacttttgaaaggaaaagattaa

DBGET integrated database retrieval system