KEGG   Lactobacillus johnsonii NCC 533: LJ_0269
Entry
LJ_0269           CDS       T00158                                 

Definition
(GenBank) UDP-N-acetylmuramoylalanyl-D-glutamyl-2,6-diaminopimelate--D-alanyl-D-alanyl ligase
  KO
K01929  UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D-alanine ligase [EC:6.3.2.10]
Organism
ljo  Lactobacillus johnsonii NCC 533
Pathway
ljo00300  Lysine biosynthesis
ljo00550  Peptidoglycan biosynthesis
ljo01100  Metabolic pathways
ljo01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:ljo00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00300 Lysine biosynthesis
    LJ_0269
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    LJ_0269
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    LJ_0269
Enzymes [BR:ljo01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.10  UDP-N-acetylmuramoyl-tripeptide---D-alanyl-D-alanine ligase
     LJ_0269
SSDB
Motif
Pfam: Mur_ligase_M Mur_ligase_C Mur_ligase DUF4043
Other DBs
NCBI-ProteinID: AAS08252
UniProt: Q74LB5
LinkDB
Position
302159..303526
AA seq 455 aa
MKMQLAEIAKALNSSVNMGEDKVITSVVFDSRKATPNSLFIPLDGARDGHDFVSNAMANG
AEATLWKKGHEGMPTDVPVIEVEDPLTALQNLAKYYLGKVNPTVVGITGSNGKTTTKDMV
AAVLSKRFNVHKTQANFNNEIGVPVTILEMKPSTEILVLEMGMDRPGQLHHLSELVRPDV
CVITMIGEAHIEFFGTRDKIADAKMEITDFLKEDGKFIYNGDEPLLEERAAKIKQEKSTF
GFREEDTVFATTFRSYMHHATFEVNGSTQQFKIPMIGKHNVSNALAAISVGRHFGENDEQ
IAQALANFTPTANRMQWKKGDVGEAIMDDVYNSNPIAVKAVTTSFGQVMVEDGGRRIAVL
GDMLELGDESADLHASLAASLDPAIINELYLYGPEMKNLYDALVDKYPAENLHYYPQDQM
NHMIDDLKNDIKPADIVMLKGSHGMHLEKVLDRLM
NT seq 1368 nt   +upstreamnt  +downstreamnt
atgaaaatgcaacttgctgagatcgctaaagcattaaatagttcagttaatatgggagaa
gacaaggtcattacatctgttgtttttgactcaagaaaagcaactcccaattctttgttt
attcccttagatggtgcaagggatggacatgattttgtatctaatgcaatggcaaacgga
gcagaagcaaccctttggaaaaaaggacatgagggtatgcctactgatgtgccagttatt
gaagtggaagatccgctaactgcgcttcaaaatttagctaaatattacttaggtaaagtt
aatccaactgttgttggtattactgggtctaacggtaagactacaactaaggatatggtt
gcagctgttttatcaaaaagatttaacgtgcataagacacaggctaactttaataacgaa
attggggtacctgtaactattttagagatgaaaccatctactgaaattttagttcttgaa
atggggatggatcgtccgggacaattacaccatttaagtgaattagtaagaccagatgtt
tgtgtcattacaatgattggtgaagctcatattgagttcttcggtactagagataagatt
gcagacgctaaaatggaaattactgacttcctaaaggaagatggtaagtttatttacaat
ggcgatgaacctttactagaagagcgtgcagctaagattaagcaagaaaagagtactttt
ggttttagagaagaagatactgtttttgcgactacatttagatcttacatgcaccatgct
acttttgaagtaaatgggtcaacacagcaatttaaaattccaatgattggaaaacataac
gtctcgaatgctcttgcagccattagtgtaggccgccattttggtgaaaatgatgaacaa
attgcccaagctttagctaacttcaccccaacagcaaatagaatgcaatggaagaagggt
gatgtaggcgaagcaattatggatgatgtttacaactcaaatccaattgcggttaaggct
gttacgacttcgtttggacaagtaatggtcgaagatggtgggcgcagaattgctgtctta
ggtgatatgttagagcttggagatgaatcagctgatcttcatgcgtctcttgcagctagc
ttggatccagcaattattaatgaactatatttatatggtccagagatgaaaaacttatat
gatgctcttgttgataagtacccagcagaaaacttgcactattatccacaagatcaaatg
aatcatatgattgatgacttaaagaatgatattaagccagctgatattgtaatgctaaag
ggatcacatgggatgcatttggaaaaggttttagaccgtctcatgtag

DBGET integrated database retrieval system