KEGG   Lactobacillus johnsonii NCC 533: LJ_0529
Entry
LJ_0529           CDS       T00158                                 

Definition
(GenBank) hypothetical protein
  KO
K17836  beta-lactamase class A [EC:3.5.2.6]
Organism
ljo  Lactobacillus johnsonii NCC 533
Pathway
ljo01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:ljo00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00311 Penicillin and cephalosporin biosynthesis
    LJ_0529
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    LJ_0529
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   01504 Antimicrobial resistance genes [BR:ljo01504]
    LJ_0529
Enzymes [BR:ljo01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.2  In cyclic amides
    3.5.2.6  beta-lactamase
     LJ_0529
Antimicrobial resistance genes [BR:ljo01504]
 Gene sets
  beta-Lactam resistance modules
   beta-Lactam resistance, Bla system [MD:M00627]
    LJ_0529
SSDB
Motif
Pfam: Beta-lactamase2
Other DBs
NCBI-ProteinID: AAS09692
UniProt: Q74HJ8
LinkDB
Position
complement(1851065..1851826)
AA seq 253 aa
MLKGRITDIIQKYDIDAGVIVKYGDQIMYQHQAEKIFPAGSLIDLAIAAYIEDQWKKTPE
VVDEKMEVTDLSRVRGAGIIGDLRRTNWSVRDLVYLTSALSDNVATNLLIEKFDIYEIDE
WLKQNYPGIRLGRELMRYSANDQDNECTAASVDKLITHLMTTQNLFCALVRKGLSNHTIP
TDLTFYGENLLTYNKLGRDRQACHEVCAFMTKKAPVFCTVLSSYEGRNIGDRLFFQELSK
LIFSHVKSADFEK
NT seq 762 nt   +upstreamnt  +downstreamnt
atgttaaagggtagaattactgacattatccaaaagtatgatattgatgcaggtgtaatt
gttaagtatggcgatcaaattatgtatcaacatcaagctgagaaaatttttccagcagga
agtttgattgacttagctattgctgcatatattgaagatcagtggaaaaagacccctgaa
gttgtggatgaaaaaatggaagttactgatctttctcgtgtgcgtggcgctggtattatt
ggtgatttacgtcgtactaattggagcgttcgagacctagtttatttaactagtgcacta
tcagataatgtagctactaatctattaattgagaaatttgatatttatgaaattgatgag
tggttaaaacagaattatcccggcatccgattgggaagagagttaatgcgctattcggct
aacgatcaagataacgaatgtacagctgctagtgttgataagttgattacacatttaatg
actactcagaatctcttctgtgctttagtgcgtaaaggattgagtaatcatactattcca
acagatttaactttttatggggagaatcttcttacctacaataaattgggccgagatcgt
caggcatgccatgaggtttgtgcttttatgacaaaaaaagcaccagtattttgcacggtt
ttgagcagttatgagggaagaaatataggggatagattattcttccaagaattaagtaag
ttgattttttcacatgtgaaaagtgctgactttgaaaaatag

KEGG   Lactobacillus johnsonii NCC 533: LJ_0665
Entry
LJ_0665           CDS       T00158                                 

Definition
(GenBank) hypothetical protein
  KO
K17836  beta-lactamase class A [EC:3.5.2.6]
Organism
ljo  Lactobacillus johnsonii NCC 533
Pathway
ljo01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:ljo00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00311 Penicillin and cephalosporin biosynthesis
    LJ_0665
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    LJ_0665
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   01504 Antimicrobial resistance genes [BR:ljo01504]
    LJ_0665
Enzymes [BR:ljo01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.2  In cyclic amides
    3.5.2.6  beta-lactamase
     LJ_0665
Antimicrobial resistance genes [BR:ljo01504]
 Gene sets
  beta-Lactam resistance modules
   beta-Lactam resistance, Bla system [MD:M00627]
    LJ_0665
SSDB
Motif
Pfam: Beta-lactamase2 PPR_3
Other DBs
NCBI-ProteinID: AAS09556
UniProt: Q74HY4
LinkDB
Position
complement(1699445..1700389)
AA seq 314 aa
MKNKIFLGAILSSFCALAFYMTSINHMKTQTLEIYGNSTAKVAQKSKMKEGTKQARITSG
ESEIGEAAISKNSNKSLAKTIVKSSSKVLGSYQVSVKDLNNSNIFADLTNTSQDNLNAGN
VLKLFVLLAYYKAVQDKSLNSATPYKVKSSDLNGGDKVLKTDMAYSYTYLLDLMMRQQNN
NAANIILNKIGKEKVNQTAKEFGASNTEITDNFGKDFAGKTSSSDLVNTMQKLYQGKILG
TNVDNQILGQLANFPEKGLAKNINGVVYRIADKKQGAAIIQEDGKTYTMAMVSEEDADLA
KIGDSINSWMIKQK
NT seq 945 nt   +upstreamnt  +downstreamnt
atgaaaaataaaatatttttaggggcgattttatcctctttttgtgcattagctttttat
atgactagtattaatcatatgaaaacacaaactttagaaatttatggaaattcaacagcc
aaagtagctcaaaaaagtaaaatgaaagaaggcactaaacaagctcgtattactagtgga
gaaagcgagattggagaggctgctatttcaaaaaatagtaataaaagcttagctaaaacc
attgttaaatctagttcaaaggttctaggaagctaccaagtaagtgtaaaagacttgaat
aattctaacatatttgctgatttaacaaatactagtcaagataatttaaatgctgggaat
gttctaaaattatttgtgttgctggcttattataaggcagttcaagataaaagtttaaac
tcggcgactccttataaagttaaatcaagtgacttaaatggtggagataaggtattaaag
actgatatggcttattcctatacatatttactggatttgatgatgcgtcaacaaaataat
aatgccgctaatattattttgaataaaattggaaaagaaaaagtaaatcaaactgcaaaa
gaatttggtgcaagtaatacggaaatcaccgataattttggtaaagattttgctggaaaa
acaagtagtagtgatctagttaatactatgcaaaagctttatcaggggaaaatcttagga
accaatgtggataatcaaattttaggacagttagctaatttccctgaaaaaggcttagcg
aaaaacattaatggtgtggtttatagaatagctgataagaaacaaggtgcagctataatt
caagaagatggaaaaacttacaccatggcaatggttagtgaagaagatgctgatctagct
aaaattggggattcgattaatagttggatgattaaacaaaaatag

DBGET integrated database retrieval system