KEGG   Lactobacillus johnsonii NCC 533: LJ_0679
Entry
LJ_0679           CDS       T00158                                 

Definition
(GenBank) hypothetical protein
  KO
K19302  undecaprenyl-diphosphatase [EC:3.6.1.27]
Organism
ljo  Lactobacillus johnsonii NCC 533
Pathway
ljo00550  Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:ljo00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    LJ_0679
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:ljo01011]
    LJ_0679
Enzymes [BR:ljo01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.27  undecaprenyl-diphosphate phosphatase
     LJ_0679
Peptidoglycan biosynthesis and degradation proteins [BR:ljo01011]
 Precursor biosynthesis
  Diphosphatase
   LJ_0679
SSDB
Motif
Pfam: PAP2 PAP2_3 Plasmod_dom_1 PAP2_C
Other DBs
NCBI-ProteinID: AAS08497
UniProt: Q74KS2
LinkDB
Position
complement(566784..567434)
AA seq 216 aa
MKKKYNNLTIHDTLIPGFIFLILYVIWALLVIYKNPFIHSFDQTIIHLLSNNNPTNVAIA
TKLTVIGNTSTLTIATIILFICLLIAKRFAYAFFSAGLMICANSYNWITKHAVERHRPLV
HHLVFADGYSFPSGHSVGSATFFGILIVLTILLVKNKSWRTILIIIWSIFPLFIGYTRIF
CHVHYPSDVIGGWLEGTTFVLLGFSVLYHLYLKKNK
NT seq 651 nt   +upstreamnt  +downstreamnt
ttgaaaaagaaatataacaatttaactatccacgatacccttattcctggatttattttt
ttaattctttatgtaatttgggcactcttggtcatttataaaaatcctttcatacattct
tttgaccaaactattattcatctactttctaacaacaatcctactaatgtagcgattgcc
actaaattaacagtaattggtaatactagtactttaaccattgctacgataattttattt
atttgcttgctgattgccaaaagattcgcctatgctttcttctcagccggcttaatgatc
tgtgccaatagttataattggattaccaaacatgccgttgaacgtcatcgccccttagtt
caccatttagtttttgctgatggttatagctttccatcgggccactcagtaggtagtgca
actttctttggtattctaatagtcttaactatccttttagtaaaaaataaatcctggcgc
actattttaattattatttggagtattttcccactttttattggttacactaggatcttc
tgtcatgtccactatccctcagacgtaattggtggatggctagaaggtacaacatttgtt
ttacttggattttccgttttataccacctctatttaaaaaagaataaataa

DBGET integrated database retrieval system