KEGG   Lactobacillus johnsonii NCC 533: LJ_0887
Entry
LJ_0887           CDS       T00158                                 

Definition
(GenBank) UDP-N-acetylenolpyruvoylglucosamine reductase
  KO
K00075  UDP-N-acetylmuramate dehydrogenase [EC:1.3.1.98]
Organism
ljo  Lactobacillus johnsonii NCC 533
Pathway
ljo00520  Amino sugar and nucleotide sugar metabolism
ljo00550  Peptidoglycan biosynthesis
ljo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ljo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    LJ_0887
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    LJ_0887
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:ljo01011]
    LJ_0887
Enzymes [BR:ljo01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.98  UDP-N-acetylmuramate dehydrogenase
     LJ_0887
Peptidoglycan biosynthesis and degradation proteins [BR:ljo01011]
 Precursor biosynthesis
  Transferase/Dehydrogenase
   LJ_0887
SSDB
Motif
Pfam: MurB_C FAD_binding_4
Other DBs
NCBI-ProteinID: AAS08708
UniProt: Q74K66
LinkDB
Position
790628..791533
AA seq 301 aa
MQLMDLRKQGIDIQENIPLSRFTFTKTGGPAQYLAFPKNLNELELLVDTVKENNIPLTVI
GNASNLIIRDGGISGLVLILTKMDTIVANKDEATVTADAGARIIDTSEAACEAGLSGLEF
AAGIPGSVGGAVFMNAGAYGGETEFVIKSVRVLTRAGEFKTYTHDEMEFGYRHSLVQETG
DIVVSATFGLEPGDKWAIKAKMEYFNGLRRAKQPLEYPSCGSVFKRPAGHFVGPMIIKAG
LQGKRIGGAEDSMKHAGFIVNVGGATATDYLDLIHLIQKTIKKDFGIDLQTEVRIIGKEK
D
NT seq 906 nt   +upstreamnt  +downstreamnt
atgcaactgatggatttaagaaaacaggggattgacattcaagaaaatattccattgagc
cgttttacttttactaagacgggaggacctgcgcagtatcttgcttttcctaaaaattta
aatgagctcgaactattagtagatacggttaaagaaaataatattcccttaactgttatt
ggaaatgcttctaacttgatcattagagatggtggtatttctggtttagttttgattttg
acaaaaatggacacaattgttgcaaataaagatgaggcaactgttacagcggatgctggg
gcaagaattattgatacatctgaagcagcatgtgaagctggtctaagtggactagaattt
gcggctggtattcctggtagtgtaggaggagccgtctttatgaatgcgggcgcctatggc
ggtgaaacagaatttgttattaagtctgttcgtgtcttaactcgtgctggtgaatttaag
acttacacacatgatgaaatggaatttggctatcgtcactccttggttcaagaaactgga
gatattgttgtgagtgctacttttggtcttgagcccggagataagtgggctatcaaagca
aagatggaatattttaatggtttacgcagagcaaaacaacctctagaatatccttcttgt
ggaagtgtttttaaacgtccagcaggacatttcgtaggaccaatgattattaaagcaggt
ctgcaaggtaaaagaatcggtggagcagaagattcaatgaagcatgctggctttatcgtt
aatgttggcggtgctacagctactgattatttagatttaattcatttaattcaaaaaaca
ataaaaaaagactttggtattgatttacaaactgaagtaagaattattggaaaagaaaaa
gattag

DBGET integrated database retrieval system