KEGG   Lactobacillus johnsonii NCC 533: LJ_0969
Entry
LJ_0969           CDS       T00158                                 

Definition
(GenBank) penicillin-binding protein 2B
  KO
K08724  penicillin-binding protein 2B
Organism
ljo  Lactobacillus johnsonii NCC 533
Pathway
ljo00550  Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:ljo00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    LJ_0969
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:ljo01011]
    LJ_0969
Peptidoglycan biosynthesis and degradation proteins [BR:ljo01011]
 Peptidoglycan biosynthesis and degradation
  DD-Transpeptidase (Class B PBP)
   LJ_0969
SSDB
Motif
Pfam: Transpeptidase PBP_dimer PASTA DUF3382
Other DBs
NCBI-ProteinID: AAS08790
UniProt: Q74JY7
LinkDB
Position
868743..870893
AA seq 716 aa
MKKFNNLNRNRSKAHGYRFTVGRILQLVLALVFLVFIGRFLYIGISNQVAGENLNKRVNQ
IYRRNEVLKATRGTIYDKNGLTLAEDAHVFTVYAILDKSSIDYHNKPMYVTNKRKTAQKL
AEVLPLSEEKIYSYLTPKHKAFQVEFGSAGTGLTLSQKERIEEMKLPGIKFIETPSRLYP
NGNFASHIIGLAQPKKNQGNSTLVGTMGIEAYFDKQLAGKDGYREAFVDAENYQLPNSQK
NARATKDGDNVYLTLDSRLQTYLEVLMSQVQDKYKPKALTAVVEDIKTGKILAASQRPTF
NPQTKKGLDTSWRNMLVQDSYEPGSVFKVLTYSSAIESGHYNPNEQYKSGAVTVQGSTIH
DWNNSGWGSIPFSQAFPRSSNVGFVKLEQKMGSKTWKEYLNKYRIGKKTGVTLPGETAGI
LNFSTPLNQAVTAFGQGVNVNAMQMMQAYSALANNGQMVKPQFVEKIVSPSGKVVEKFHR
TKVGTPIYSAKTAKTVLKGMQDVVNASYGTGAAYKMPGKSIAVKTGTAQIAGPHGGYLTG
DNNYIFSVVGVTPANNPRYCVYLTMKQPQKMSKPAETILSSIFKPIMNRLISLSDSSAKV
NEKVTVPALTGKSVEKAKEDANNAGVSVEVIGTGKNVSRQSVGAGVKEDTDTKIFLYTGG
KVTCPNMVGWSEDEVNSFMTTTDIPITINGKGKVTKQSIPAGKVIDKNSKLSVNLK
NT seq 2151 nt   +upstreamnt  +downstreamnt
atgaaaaagtttaataacttaaatagaaatagatccaaagcccacggctaccgctttacg
gtggggagaatcctccagctagtcttggctttggtttttcttgtatttataggtagattt
ttatatatagggatttcaaatcaggttgctggcgaaaacctaaataagcgtgtaaatcag
atttataggcgaaatgaggttttaaaggcaacccgaggaacaatttatgataaaaatggt
ttaactcttgctgaagatgcgcatgtctttactgtatatgccatcttagataagagttca
attgattatcataataagccaatgtatgttacgaataaacgcaaaacagcacaaaagttg
gctgaagtacttcctttaagtgaggaaaagatatattcatatttgactccgaagcataaa
gctttccaggttgaatttggttcggctggaacaggtttaactttatctcaaaaggaaaga
atcgaagagatgaagttgccaggaattaaatttatcgaaactccatctagactttatcct
aatggaaattttgcttctcacattattggtttggcacaacccaaaaagaaccaaggaaac
agtactttagttggtacgatgggaattgaagcatactttgataaacaattggcaggtaaa
gatggttatcgcgaagcttttgttgatgcagaaaattatcaattacctaatagccaaaag
aatgcacgtgctacaaaagatggagacaatgtttacttgacacttgattcacgactgcaa
acttacttagaggttttaatgtcgcaagtgcaagataaatacaagccaaaagctttaaca
gcagttgtagaagatattaaaactggtaaaattctggctgcttctcagcgtcctaccttt
aatcctcaaactaaaaagggattagatacatcatggcgaaatatgttagtgcaggattcc
tatgaaccgggatcagttttcaaagttttaacttattcaagtgcaattgaaagtggtcat
tacaatcctaatgaacaatacaagtctggagcagtcactgttcagggctcaacaattcat
gactggaacaatagtgggtggggaagcattccatttagccaagcatttcctcgttccagt
aatgttggttttgtaaaacttgaacaaaagatgggttcaaaaacttggaaagaatatttg
aataaataccgaatcggtaaaaagacaggggtaacgcttcctggagaaaccgcaggtatt
ttaaacttttctactccgttgaatcaggctgttactgcatttggacaaggggttaatgtt
aatgcaatgcaaatgatgcaagcatatagtgccttggccaataatggtcagatggtaaaa
cctcaatttgtcgaaaaaatagtttcaccttctggtaaagtagtagaaaagtttcaccgt
acaaaagtcgggacacctatttattctgctaaaacagctaaaactgttctaaaaggaatg
caagatgttgtaaacgcatcttacggtactggtgcagcttataaaatgccaggaaagagc
atcgctgtaaaaactggtacggcacaaatagctggaccgcatggtggatatttgactggg
gataataattatattttttcagtagttggggtaacacctgctaataatcctcgttattgt
gtttatttaaccatgaagcaaccacaaaaaatgtccaaaccagctgaaacaattctttct
tctatttttaaaccaattatgaatcgcttgatttcactttctgattcttcagcaaaggtt
aatgaaaaagtaactgttccagctttaactggtaaaagtgttgaaaaagcaaaagaagat
gctaataatgcaggagtttcagttgaagtgattggaactggaaagaatgttagtcggcag
tcagtaggagccggtgtaaaagaagataccgatacaaagattttcctatatactggagga
aaagttacatgtccaaatatggttggctggagcgaagatgaagttaatagcttcatgacg
acaactgatattccaattacgattaatggaaaaggaaaagttactaaacagtctattccg
gctggaaaagtaattgataaaaatagtaagctatctgtaaacttaaaatag

DBGET integrated database retrieval system