KEGG   Lactobacillus johnsonii NCC 533: LJ_0970
Entry
LJ_0970           CDS       T00158                                 

Definition
(GenBank) phospho-N-acetylmuramoyl-pentapeptide-transferase
  KO
K01000  phospho-N-acetylmuramoyl-pentapeptide-transferase [EC:2.7.8.13]
Organism
ljo  Lactobacillus johnsonii NCC 533
Pathway
ljo00550  Peptidoglycan biosynthesis
ljo01100  Metabolic pathways
ljo01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:ljo00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    LJ_0970
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    LJ_0970
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:ljo01011]
    LJ_0970
Enzymes [BR:ljo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.8  Transferases for other substituted phosphate groups
    2.7.8.13  phospho-N-acetylmuramoyl-pentapeptide-transferase
     LJ_0970
Peptidoglycan biosynthesis and degradation proteins [BR:ljo01011]
 Precursor biosynthesis
  Glycosyltransferase
   LJ_0970
SSDB
Motif
Pfam: Glycos_transf_4 MraY_sig1
Other DBs
NCBI-ProteinID: AAS08791
UniProt: Q74JY6
LinkDB
Position
870918..871877
AA seq 319 aa
MQFSLIPFISSFALTVIFLPLFIGFMRMKHEGQVIRDEGPKWHEKKSGTPTMGGVVFMLA
GVISTLWVLIWQKDLNKTAWILIIAFLGYGIIGFLDDGIKLYFKRNLGLRAWQKLLGQII
IAALIITLAFSDHFAFELYIPFAGMVRNSFLFSLFVLFWLVGFSNAVNLSDGLDGLATGL
SIIAYATYAWIAYQERNWVIVVFTLSVIGGLVGFFIFNHKPAKIFMGDAGSLALGGGLAT
VSIFLHRPWSLLLIGIVFVLETLSVILQVISFQTTGKRIFKMTPIHHHFEMLGWSEWKVD
IVFWIVGLIGSIIYLIIWG
NT seq 960 nt   +upstreamnt  +downstreamnt
atgcagttttctttgataccgttcattagcagctttgctcttacggttatcttcttaccg
ttgtttattggtttcatgcgaatgaaacatgaaggacaagttattagagatgaaggccct
aagtggcatgagaaaaaatcaggtacaccaactatgggtggagtagtctttatgcttgcc
ggtgttatttctaccttatgggtgttgatttggcaaaaagatttaaataagactgcatgg
attttaattattgctttcttaggatacggaattattggctttttagatgatggaattaag
ctatatttcaaacgtaacttaggcttgagagcatggcaaaaattattaggacaaattatt
attgcagctttaattattacactagcctttagtgatcattttgcctttgaattatatatt
ccttttgcaggaatggtaagaaattccttcctctttagtttatttgtccttttctggttg
gttggtttttctaacgcagttaacttatctgatggtttagatggattagcaactggttta
tccattattgcttatgctacttatgcttggatagcttaccaagaaagaaattgggttatc
gttgtatttactctcagtgtaattggtggtttagtaggtttcttcattttcaatcataag
ccagctaaaattttcatgggagatgcaggttcattagctttaggtggaggattagccact
gtatcgattttccttcatcgtccatggtcattgctgttaattggaattgtttttgtatta
gaaactttaagtgtgatcttacaagttatttccttccaaactactggaaagagaattttc
aagatgacaccaatccatcaccatttcgaaatgcttggctggtctgaatggaaggttgat
attgtattttggattgttggtttaattggaagtattatttatttaattatctggggttaa

DBGET integrated database retrieval system