KEGG   Lactobacillus johnsonii NCC 533: LJ_0971
Entry
LJ_0971           CDS       T00158                                 

Definition
(GenBank) UDP-N-acetylmuramoylalanine--D-glutamate ligase
  KO
K01925  UDP-N-acetylmuramoylalanine--D-glutamate ligase [EC:6.3.2.9]
Organism
ljo  Lactobacillus johnsonii NCC 533
Pathway
ljo00471  D-Glutamine and D-glutamate metabolism
ljo00550  Peptidoglycan biosynthesis
ljo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ljo00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    LJ_0971
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    LJ_0971
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:ljo01011]
    LJ_0971
Enzymes [BR:ljo01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.9  UDP-N-acetylmuramoyl-L-alanine---D-glutamate ligase
     LJ_0971
Peptidoglycan biosynthesis and degradation proteins [BR:ljo01011]
 Precursor biosynthesis
  Amino acid ligase
   LJ_0971
SSDB
Motif
Pfam: Mur_ligase_M Mur_ligase_C 2-Hacid_dh_C TrkA_N
Other DBs
NCBI-ProteinID: AAS08792
UniProt: Q74JY5
LinkDB
Position
871885..873267
AA seq 460 aa
MKKIKTYENKNILILGLGKSGFSVAKLLLKLGAKLTLNDKKDLSNDDRAAELGKLGVRVI
SGYHPVEIFDEEKFDYLVKNPGIPYENPMVEKAEKLDIPVITEPEIALNVSEAPYVCVTG
SNGKTTTVMLTQRIMDHNLSKNGGHAYAVGNIGVPISEVVEKATSKDLLVVEMSSFQLLG
VTDIKPKVAAIVDIYNNVHLDYHKTFDNYVEAKLRITQSQDQDDYFIANFDQKNILEKEL
DKTKAKVQTFSETDKTADYFIGDEYLESKDDHHIMKISDIKIPGIHNQQNCLVAIAISKL
MGADDSDIQYALSTFTGATHRLQYVMTYNDRKIYNDSKSTNIEAATVAIPSFKEPEVLIA
GGLDRGFMFDSLVPLFKKHVKSIVLYGETKYLLADAARKAGIKDIVIVNTLQEAVPRAYE
LSEAGDVILFSPACASWDQFNTFEERGDFFVKFIKELKTK
NT seq 1383 nt   +upstreamnt  +downstreamnt
atgaaaaaaattaagacatacgaaaataaaaatattttgattttaggcttaggaaaaagt
ggtttttctgttgctaagcttcttttaaagcttggcgctaagctgactttaaatgataaa
aaagatttgtctaacgatgatcgtgctgctgaattaggcaagttaggagttagagttatt
tctggataccatccagtagagatctttgatgaggaaaaatttgattatcttgttaaaaac
cccggaattccttatgaaaatccaatggtagagaaggcagagaagttagatattccagtt
attaccgaacctgaaattgcacttaatgtcagtgaagcaccatatgtttgtgttactggc
tcaaatggaaagacaactacggtcatgcttacccaaagaattatggatcataatttatct
aaaaatggtggtcatgcttatgcagttggtaatattggtgttccaatttcagaagttgtt
gaaaaagcaacttctaaagatctcctagtagtagaaatgtctagtttccaattacttggg
gtaactgatattaagcctaaagtagctgccattgttgatatttataataatgttcacctt
gactaccataagacttttgacaattatgttgaagctaagcttagaattactcaatctcaa
gatcaagatgattatttcattgctaactttgatcaaaagaatattttagaaaaagagctt
gataagacaaaagctaaggttcagacattttcggaaacagataaaactgccgactatttt
attggtgatgaatatcttgaaagcaaagacgatcatcacattatgaagatcagcgatatc
aagatcccaggtattcataaccaacaaaattgtttagtagcgattgccatttctaaatta
atgggtgcagatgatagtgacattcaatatgcattaagtacttttactggtgcgactcac
cgtttgcaatatgtaatgacttataatgatcgtaaaatttataacgattcaaaatcaacg
aatattgaagctgctactgtagcgattccatcatttaaagagcctgaggttttgattgcg
ggtggattagatcgtggatttatgtttgattcactagttccactatttaaaaagcatgta
aaatcaattgtactttatggcgaaactaaatatcttttagctgatgccgctcgtaaagcg
ggtattaaagatatcgtaattgttaatactttacaagaagctgttccgcgagcatatgaa
ttaagtgaagcaggagatgttattttgttttcaccagcatgtgcatcttgggatcaattt
aacacttttgaagaacgtggagacttttttgtaaaatttattaaggaattaaagactaaa
taa

DBGET integrated database retrieval system