KEGG   Lactobacillus johnsonii NCC 533: LJ_0972
Entry
LJ_0972           CDS       T00158                                 

Definition
(GenBank) UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase
  KO
K02563  UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [EC:2.4.1.227]
Organism
ljo  Lactobacillus johnsonii NCC 533
Pathway
ljo00550  Peptidoglycan biosynthesis
ljo01100  Metabolic pathways
ljo01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:ljo00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    LJ_0972
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    LJ_0972
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:ljo01011]
    LJ_0972
Enzymes [BR:ljo01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.227  undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase
     LJ_0972
Peptidoglycan biosynthesis and degradation proteins [BR:ljo01011]
 Precursor biosynthesis
  Glycosyltransferase
   LJ_0972
SSDB
Motif
Pfam: Glyco_transf_28 Glyco_tran_28_C UDPGT Epimerase_2 Glycos_transf_1 BING4CT RHH_3 CmcI Glyco_transf_4
Other DBs
NCBI-ProteinID: AAS08793
UniProt: Q74JY4
LinkDB
Position
873270..874382
AA seq 370 aa
MRVIFSGGGTGGHIYPIMALIERLKERKLVTNDEILFVGTDRGLESKIVPAAGVPFKTLK
IKGFDRKHPLKNFETIELFIKATKEAKQIIKNFKPDVVVGTGGYVSGAIVYEAAKMHVPT
IIHESNSVVGLANKFLAHYVDKICYTFDDAAKQFSEKKKLVKTGNPRSQQVLGLNKENID
IAKKWDLNPNMPTVLIFGGSRGALAINQIVEKSLSELETKPYQVIWATGQLYYGDVKKKL
AGKEVNSNIKIVPYIDNMPGLLPQMTCVVARSGATSLAEFTALGVPVILIPSPNVTHNHQ
MKNALDMEKAGAALVIAENDLNPNNFVSSIDHILLDTNYAKKMSEASKKLGVPDASDQVI
SVMESLIKNK
NT seq 1113 nt   +upstreamnt  +downstreamnt
atgagagtaattttttctggtggcggaactggtggccacatatatccaattatggcgtta
attgaacgtttgaaagaacgtaaattagttacaaatgatgaaattttgtttgttgggact
gatcgaggattagaatcgaagattgttcctgcggcaggagttccttttaagactttaaaa
atcaaaggatttgatcgaaaacatcccctaaagaatttcgaaacaatcgaattatttatt
aaagctacaaaagaagcaaaacaaattattaagaactttaaacctgatgtagtcgttgga
actggtggatatgtatcaggtgccatagtttatgaggcagctaaaatgcatgttccaact
atcattcatgaatctaattcagtagttggactagcaaataagtttttagctcattatgtt
gataaaatttgttatacctttgatgatgctgcaaagcaattttcagagaaaaagaaatta
gtaaaaactggtaatccacgctcacaacaagttcttggtttaaataaagaaaacattgat
attgctaagaaatgggatttaaatcctaacatgccaactgtacttatttttggtggctca
cgcggtgctttagcaattaatcaaatcgttgaaaagtctttatcagagcttgaaacaaaa
ccatatcaggttatttgggcaactggacaattgtattatggtgatgttaagaaaaaatta
gccggtaaagaagtgaattcaaatataaagattgttccttatatcgataatatgcccggc
ttactaccacaaatgacatgtgttgtagcacgatctggagcaactagtctggctgaattt
actgcccttggtgtccctgtaattttaattcctagtccaaatgtaacgcataatcatcaa
atgaaaaatgcgcttgatatggaaaaagcaggagctgctttagttattgcagaaaatgat
ttaaatcctaataactttgtttcatcaattgatcatattctactcgatacaaattatgca
aagaagatgagtgaagcatctaagaaattaggtgttccagatgcatctgatcaagtaatt
tcggtgatggaaagtctaattaaaaataaatag

DBGET integrated database retrieval system