KEGG   Lactobacillus johnsonii NCC 533: LJ_1157
Entry
LJ_1157           CDS       T00158                                 

Definition
(GenBank) ABC transporter ATPase and permease components
  KO
K18104  ATP-binding cassette, subfamily B, bacterial AbcA/BmrA [EC:7.6.2.2]
Organism
ljo  Lactobacillus johnsonii NCC 533
Pathway
ljo01501  beta-Lactam resistance
ljo02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:ljo00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    LJ_1157
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    LJ_1157
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ljo02000]
    LJ_1157
   01504 Antimicrobial resistance genes [BR:ljo01504]
    LJ_1157
Enzymes [BR:ljo01000]
 7. Translocases
  7.6  Catalysing the translocation of other compounds
   7.6.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.6.2.2  ABC-type xenobiotic transporter
     LJ_1157
Transporters [BR:ljo02000]
 ABC transporters, eukaryotic type
  ABCB (MDR/TAP) subfamily
   ABCB-BAC subgroup
    LJ_1157
Antimicrobial resistance genes [BR:ljo01504]
 Gene sets
  Multipdrug resistance modules
   Multidrug resistance, efflux pump AbcA [MD:M00700]
    LJ_1157
SSDB
Motif
Pfam: ABC_membrane ABC_tran SMC_N ABC_membrane_3 RsgA_GTPase SbcCD_C AAA_29
Other DBs
NCBI-ProteinID: AAS08979
UniProt: Q74JF0
LinkDB
Position
1076997..1078748
AA seq 583 aa
MDRGRPRIEKGKHSFSFQDFFKLINRVHPKYWQLIVGILAGLIATGANLIVPQFAQRIIN
NFKHLNINLVIITGIVFFGGVIISALSGYILGVFGEHVVSKLRDNLWARLLKMPVSYFDN
TSTGEISSRLVNDTSQVKNLLANTLPNAITSLLQFFGAVVIMFMMDWQMSLIMVLAVPLV
IFVLLPFMRLSGKIGRARQDELAKFSSDSTNVLSEIRLVKSSNSEKKELATGTKRIAKLY
AIGVKESWINSLMQPISNMLMMILVIGILTYGAIRVMQGTLTMGALISFLMYLFQLMGPV
IIISQFFNELAKTSGSTERIGEMLNEPIEVSADNQKVDIAGKELKLQNVSFSYEKGKQIL
HDINVSAKPNTVVAFAGPSGGGKSTIFSLIERFYKPTSGKITIGGQNIEEIDLTDWRKQI
GLVGQNSSVMPGTIRENLVYGLGRKVSDDELWHVLKMAYADKFVKEAEDGLETQIGERGV
KLSGGQRQRIAIARAFLRDPKILMLDEATASLDSESEAMVQKALASLMKNRMTLVIAHRL
STIVDADKIYFIDHGTVSGSGTHDELVKSTPLYAEYVHNQFKK
NT seq 1752 nt   +upstreamnt  +downstreamnt
atggatagaggaagaccccggattgaaaaaggaaaacatagttttagttttcaagatttt
tttaaattaataaatcgagtgcatcccaaatattggcaattaattgttggtattctggct
ggcttaattgccacgggagcaaacttaattgttcctcaatttgcacaaagaattattaat
aactttaagcatttaaatataaacctggtaattattactggaatagtattttttggtgga
gtaattattagtgccttatctggttatattttgggagtttttggagagcatgtggtttcg
aaacttcgtgataatctctgggctcgcttacttaagatgccagttagttattttgataat
acttcgacaggtgaaatttcatcaagactagttaatgacacgtcacaagtcaagaattta
cttgctaataccttgccgaatgcaattacttctttattacaattctttggtgctgtcgtc
atcatgtttatgatggattggcagatgtccttaatcatggttcttgctgttcctttagtg
atatttgtcctactaccatttatgagattgtcaggaaaaattggccgggcacgtcaagat
gaactggcaaaattttctagtgattcaactaatgttttaagtgagatccgtttggtaaaa
tcaagtaattcagagaagaaagagcttgctacaggaacaaaaagaattgctaaactttat
gcaattggggtaaaggaatcctggattaactccttgatgcagccaatttctaatatgtta
atgatgattttagtaattggtattttaacttacggtgctattcgtgtcatgcaaggtaca
cttactatgggtgcacttatttccttcttaatgtatctatttcaattgatgggtccagta
atcataattagtcaatttttcaatgaattagctaagacgtcaggttcaactgaacgtatc
ggcgaaatgcttaatgaaccaattgaagtatctgccgataatcaaaaggttgatattgct
ggaaaagaattgaagttgcagaatgtaagtttctcatatgaaaaaggaaagcaaattcta
catgatatcaatgtgtcggcgaagcctaatactgttgtcgcatttgctggtccatcaggt
ggtggaaaatcaacaattttttcattaatagaacggttctataaaccaacttcgggaaag
ataactattggtggtcaaaatatagaagagattgatttaactgattggcgtaaacaaatt
ggacttgtaggtcaaaattcatcagtaatgccaggaactattcgcgaaaatcttgtttat
ggactaggaagaaaagttagtgacgatgaattatggcatgttttaaagatggcatatgca
gataaatttgtaaaagaggcagaagatggcttagaaacacagattggtgaacgaggcgtg
aagctatcaggtggacaaagacagagaattgcaattgccagagcttttttacgtgatcct
aaaatcttaatgcttgatgaggctactgcaagtcttgattcagaatctgaagctatggta
caaaaagctttagcaagtttgatgaaaaacagaatgactttagtaatcgcacaccggcta
agtacaattgttgatgcagataaaatttattttattgaccatggaactgtttccggctca
ggtactcatgatgaactagtaaaatcgacacccctttatgcagaatacgttcataatcaa
tttaaaaaatag

DBGET integrated database retrieval system