KEGG   Lactobacillus johnsonii NCC 533: LJ_1496
Entry
LJ_1496           CDS       T00158                                 

Definition
(GenBank) undecaprenyl pyrophosphate synthetase
  KO
K00806  undecaprenyl diphosphate synthase [EC:2.5.1.31]
Organism
ljo  Lactobacillus johnsonii NCC 533
Pathway
ljo00550  Peptidoglycan biosynthesis
ljo00900  Terpenoid backbone biosynthesis
ljo01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ljo00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    LJ_1496
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    LJ_1496
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01006 Prenyltransferases [BR:ljo01006]
    LJ_1496
Enzymes [BR:ljo01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.31  ditrans,polycis-undecaprenyl-diphosphate synthase [(2E,6E)-farnesyl-diphosphate specific]
     LJ_1496
Prenyltransferases [BR:ljo01006]
 Terpene biosynthesis
  Prenyl diphosphate synthase
   LJ_1496
SSDB
Motif
Pfam: Prenyltransf
Other DBs
NCBI-ProteinID: AAS09264
UniProt: Q74IR9
LinkDB
Position
complement(1368763..1369482)
AA seq 239 aa
MSESKKPLNHLAIIMDGNGRWAKKRHLPRFVGHRHGMDNIRNIALAANKLGIKVLTLYAF
STENWARPTDEVNYLMRLPIDFFDKFMPELMENNVRVNIMGFVDELPEKTYLVTQKAMAE
TANNTGMVLNFAFNYGSRREITAGVQEIARKVKVGEIDIDDISEKMVSDHLLTHSLAPYE
DPDLLIRTSGEERLSNFLLWQMAYTEFSFSDKLWPDFDKTDLEELVKDYQGRNRRFGKV
NT seq 720 nt   +upstreamnt  +downstreamnt
atgtcagaatcaaaaaaaccacttaatcatttagccataattatggatggaaatggtaga
tgggcaaaaaaaagacatttaccacgttttgtcggacatcgtcatggtatggataatatt
cgaaatattgctcttgccgccaataaattaggaataaaagttttaacactttatgctttt
tcaactgaaaattgggctcgtccgactgacgaagtaaactatttgatgcgtttaccaatt
gacttttttgataagtttatgccggaactaatggaaaataacgttcgggttaatatcatg
ggatttgtagacgaattacctgagaagacatatttagtaacccaaaaagccatggcagaa
acagctaataatacaggaatggtattgaattttgcctttaactatggatcgcgtagagaa
ataacggctggagtacaagaaattgctcgtaaggtaaaagtcggggaaattgatattgat
gatattagtgaaaaaatggtctcagatcatttgctgactcattctttagctccatatgaa
gatcctgatttattaattagaacatctggagaagaacgtttatcaaatttcttattgtgg
caaatggcctatactgaatttagtttttcagataaattatggccagattttgataaaact
gatttagaagaattagttaaagattatcaaggacgtaatcgtcgttttggaaaagtataa

DBGET integrated database retrieval system