KEGG   Lactobacillus johnsonii NCC 533: LJ_1620
Entry
LJ_1620           CDS       T00158                                 

Definition
(GenBank) penicillin-binding protein 2B
Organism
ljo  Lactobacillus johnsonii NCC 533
SSDB
Motif
Pfam: Transpeptidase PBP_dimer
Other DBs
NCBI-ProteinID: AAS09392
UniProt: Q74IE6
LinkDB
Position
complement(1493666..1495765)
AA seq 699 aa
MNYLKQSKGSNRNSTSTPLRMKIILGVILVLFLFLIGQLAYLQLFYGGRFQAEVQQTDQK
IVSNNVPRGVMYDSSGKVLVGNKANNAITYTKNSSITSSQIYKISNRLSQYITLDDEEPT
QRQLYDYYLANSKISEKETAKLPRSERYDSNGDALSSSQIYNNVLKRVEKQDIHFTKRQK
TAALIFNKISGAYTLSTIYIKNKGLTDREMALVGEHLSELPGVGIGTDWSRSYPNGKSIK
SIIGSVSSEKAGLPSDNLQYYLTQGYSRNDRVGTSYLEEKYEPLLKGTKSKSQVVTKSGD
GVEQTKTVYKGQSGASLILTMNAKYQQQVEDALKKQYAAAKAAGATQYSNGAYAVAMNPK
TGALLAIAGIDHNAKTNKDTDDALGVINKSFVMGSAVKGATVAGGLMNGVITPTNNVMPD
TPIYLPGSPIKKSVYPVGTFGSLDAPTALEVSSNIYMMQLALRWVNAKYTPHSFISMPSD
AFTKLRRNFAMFGLGQKTGVDLPGEVSGIQGRSYNSAGQLLTGSVLDLSYGNYDAYTPIQ
LVQYISTIANGGYRMRPYLVQSVGETNSQGNKVSILHNTKPQVQMRIPWTQDQLDVIHQG
MYRVVHGTNSWGTAHSLKNVKPSISGKTGTAQTFYYDEDNPGNPNAPEVINATFVGYAPS
KDPEIAVAVVFPGLDPDKEGSYTLQVAKAMVEDYFKLNK
NT seq 2100 nt   +upstreamnt  +downstreamnt
ttgaattatttaaaacagagtaaaggttcgaatagaaattccacttcgacgcccctaaga
atgaaaattattttgggcgtcattttagttttatttttattcttaattggtcaattggcc
tacttacagcttttctacggtggacgttttcaagcagaagtacagcaaaccgaccaaaag
attgtatcaaataatgtaccacgtggtgtgatgtatgatagcagcggtaaagttttggta
ggtaataaagctaataacgcaattacttataccaaaaattctagcattacgtctagtcaa
atatataaaatttctaatcgcttaagtcaatatataacacttgatgatgaagaacctacc
caaagacagctttatgattattatttagctaacagtaaaatatcagaaaaggaaacagct
aagctgcctcgatctgaacgttatgacagtaatggggatgctttaagttcaagtcaaatc
tataacaatgtcttaaaacgtgttgaaaagcaagatatccattttactaaacgtcaaaaa
acggctgctttaatttttaataagatttctggagcatacactttatctactatctatatt
aaaaataaaggtctaactgatagagaaatggcattagttggagagcacctatctgaattg
ccaggtgtaggtattggaactgactggtccagaagctatccaaatggaaaatccattaaa
agtatcattggttccgtttcttcagaaaaagctggtttaccaagtgataacttgcagtac
tacttaacacaaggttactcacgaaatgaccgtgtaggtacaagttacttagaagaaaag
tatgagccgcttctgaaaggaactaagtctaagtcacaggtagttactaagtccggagat
ggtgttgaacaaactaagactgtctataaaggacaaagtggtgccagtttgattttgaca
atgaatgctaaatatcaacaacaagtagaagatgcactgaagaagcaatatgcggctgct
aaagctgcaggtgctacgcagtattctaatggtgcctatgcagtagcgatgaatccaaag
actggagcacttttagcgattgcaggtattgatcataatgcaaagactaataaagatact
gatgatgcgttaggtgtaattaataaatcctttgttatggggtctgcagtcaaaggggca
actgttgcgggtggattaatgaatggtgttattacaccaactaacaacgtaatgcccgat
acgccaatttacttgccaggttctccaattaagaaatctgtttacccagttggtacattt
ggtagtcttgatgccccaacagctcttgaagtatcaagtaacatttacatgatgcaatta
gctttaagatgggtaaatgctaaatatactccacatagttttatctcaatgccttcagat
gcatttactaaattgagacgtaattttgcaatgtttggtttgggtcaaaaaactggtgta
gaccttcctggagaagtttcaggtattcaaggtcgctcatataactcagctggtcaattg
cttacaggttctgttcttgacttgtcttacggaaactatgatgcttatacaccaattcaa
ttagtacaatatatttcaactattgctaatggtggttatcgtatgcgtccatatttagtt
caatcagttggtgagactaattcgcaaggtaataaagtatcaattcttcataacactaag
ccgcaggttcagatgcgtattccttggacgcaggatcaacttgatgttattcatcaaggg
atgtatcgtgttgttcatggtactaattcatggggaacagcccattcattaaagaatgtt
aagccttcgatttctggtaagactggtactgctcagactttttattatgatgaagataac
ccaggtaatccgaatgcgccagaagttattaacgctacttttgttggttatgccccatca
aaggatcctgaaatcgctgtagctgtggtcttcccaggactggacccagataaagaaggt
tcatatactttgcaagtggcaaaggcaatggttgaagactacttcaaacttaataaatag

DBGET integrated database retrieval system