KEGG   Lactobacillus johnsonii NCC 533: LJ_1663
Entry
LJ_1663           CDS       T00158                                 

Definition
(GenBank) UDP-N-acetylmuramate-alanine ligase
  KO
K01924  UDP-N-acetylmuramate--alanine ligase [EC:6.3.2.8]
Organism
ljo  Lactobacillus johnsonii NCC 533
Pathway
ljo00471  D-Glutamine and D-glutamate metabolism
ljo00550  Peptidoglycan biosynthesis
ljo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ljo00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    LJ_1663
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    LJ_1663
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:ljo01011]
    LJ_1663
Enzymes [BR:ljo01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.8  UDP-N-acetylmuramate---L-alanine ligase
     LJ_1663
Peptidoglycan biosynthesis and degradation proteins [BR:ljo01011]
 Precursor biosynthesis
  Amino acid ligase
   LJ_1663
SSDB
Motif
Pfam: Mur_ligase Mur_ligase_M Mur_ligase_C
Other DBs
NCBI-ProteinID: AAS09436
UniProt: P61680
LinkDB
Position
complement(1537210..1538523)
AA seq 437 aa
MLDKNKQIWFIGIKGTGMASLALVLHDLGYNVAGSDIEKYTFTQVPLEKAGIEVKNFDPA
NIKSNAEQVIVKGNAFKQDNPEVAACLDKNVEWQSYPDTVEEIVQMHTSIGVSGTHGKTS
TTSLLAHVLGEVAPTSYLIGDGRGKGVEGSRFFVYEADEYRRHFLAYHPDYQIMTNIDFD
HPDYFKDQDDYTSAFQTAADQTKKALFVWGDDKRLQSLKTDIPKYTYGFKDTDDFQAVNI
EKTTTGSKFNVLAHGKDLGRFEIHLFGDHSILNTTAVIAVAYTEKVPMDDIKEGLLTFKG
AKRRFAEKDFGDVSVIDDYAHHPTEMRATIQAARQKFPDKELVVVFQPHTFSRTKKYQKD
FEEILRDVDKAYVTPIYASAREASGDISSEDLVNNIPGSEVIDLDNIADLTKHKNAVVVF
MGAGDIPKYEDAYEKLL
NT seq 1314 nt   +upstreamnt  +downstreamnt
atgttagacaaaaataaacaaatttggttcattggtattaaaggaactggtatggcatcc
ctagctctagttttacatgacctaggttataacgttgcaggttcagatattgaaaaatat
acgtttactcaggtacctcttgaaaaagctggtattgaagtaaaaaattttgatccggcc
aatattaagagcaatgcagaacaagtaattgttaaagggaatgcttttaaacaagataat
cctgaagtagcagcatgtttagacaaaaatgttgaatggcaaagctatcctgatacagtt
gaagaaattgtacagatgcatacttcaattggtgtatccggtactcacggtaagacttca
actactagtcttttggcacacgttttaggtgaagttgcaccaacttcttacttgattggt
gatggtcgcggtaaaggagtagagggctcacgtttctttgtttatgaagctgatgaatac
cgtcgtcacttcttggcatatcatccagattaccaaattatgactaacattgactttgat
caccctgattactttaaggatcaagatgattacactagtgcttttcaaactgcagctgat
caaactaagaaggctctctttgtttggggagatgacaagcgtttgcaaagtttaaagact
gatattcctaagtatacttatggcttcaaggatactgatgattttcaagcagttaatatc
gaaaagacaactactggctctaaatttaatgttttagcacatggaaaagaccttggccgt
tttgaaattcacttatttggtgatcacagtattttaaacactactgctgtaattgcagtt
gcttatactgaaaaggttccaatggatgatattaaggaaggtctgcttactttcaagggt
gcaaaaagacgttttgccgaaaaagattttggggatgtttccgtaattgatgattatgct
caccacccaacagaaatgcgcgcaactattcaagctgctcgtcaaaaattcccagataaa
gaattagtggtagttttccaaccacatactttctcaagaactaagaaataccaaaaggac
tttgaagaaattttgcgtgatgttgataaagcatatgttactcctatctatgcatctgct
cgtgaagcaagtggagatatttcaagtgaagatttagtaaataatattcctggttcagaa
gtaattgatttagacaacatcgctgatttaactaagcacaagaatgcagttgttgtattt
atgggtgctggtgatattcctaagtatgaagatgcttatgaaaagttactttaa

DBGET integrated database retrieval system