KEGG   Lactobacillus johnsonii NCC 533: LJ_1721
Entry
LJ_1721           CDS       T00158                                 

Definition
(GenBank) ATP-dependent DNA helicase PcrA
  KO
K03657  DNA helicase II / ATP-dependent DNA helicase PcrA [EC:3.6.4.12]
Organism
ljo  Lactobacillus johnsonii NCC 533
Pathway
ljo03420  Nucleotide excision repair
ljo03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:ljo00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03420 Nucleotide excision repair
    LJ_1721
   03430 Mismatch repair
    LJ_1721
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ljo03400]
    LJ_1721
Enzymes [BR:ljo01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     LJ_1721
DNA repair and recombination proteins [BR:ljo03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     LJ_1721
   MMR (mismatch excision repair)
    Other MMR factors
     LJ_1721
SSDB
Motif
Pfam: UvrD_C UvrD-helicase AAA_19 UvrD_C_2 AAA_30 Viral_helicase1 ResIII AAA_16 PRMT5 DEAD
Other DBs
NCBI-ProteinID: AAS09492
UniProt: Q74I48
LinkDB
Position
complement(1605634..1607880)
AA seq 748 aa
MSEETILAGLNPQQKKAVQCTEGPLLVVAGAGSGKTSVLTRRIAYLIEEKGVAPWNVLAI
TFTNKAASEMKERVQKLLGPAADSVWMSTFHALCVRILRRDAKKIGYSNNFSIADSAEQL
TLIKRIEKDLNINPKMYDPKAILGAISNGKNDLLTPKDFKEQAASPFEKVTAQVYSEYQH
RLKRDQIMDFDDLIMQTLVLFKKDKETLHYYQNKFRYILVDEYQDTNEAQYQLCVALAAQ
YKNICVVGDADQSIYGWRGANMENILNFEHDYQDDEVTTIKLEQNYRSTGHILDAANSVI
KNNLKRKPKKLWTDKGAGDKINYYRAQSGNDEALFIISKIKEEIKKHQRDYKDFAVLYRT
NAQSRNVEEALVKANIPYRIVGGHKFYDRKEIKDILAYLKVVANPADSMSFNRIINVPKR
GLGPTTMAKFNGFANDNDFTVEETFKNLSLAPITGRPARTLATFGTALKDAIEYSKTHGV
TGLTEKILADFGYKEALENEHTIEADTRLENLNEFLTVTKRFDDNYEPEDEDSTALGDFI
SEISLLSDQDDLENQDNQVALMTLHAAKGLEFPVVFLVGMEEGLFPLSRAVEDPSELEEE
RRLAYVGITRAEKKLYITNAFSRMMYGRPQRNQPSRFIDEIEDKDLEFVNPMPSNSVISV
PFAINRKKQANSHVYPPKMTIEEAKKATGAVGAEKKSWNVGDQVTHKAWGKGVVVKVNGT
GEDMELDIAFASQGVKRLLAAFAPIKKI
NT seq 2247 nt   +upstreamnt  +downstreamnt
atgagcgaagaaacaattcttgcaggattaaatcctcagcaaaaaaaagccgtgcagtgt
actgaaggtccacttttagtagttgccggagctggtagtggaaaaacatcagttttaaca
cgtcgaattgcctatttaattgaagaaaagggcgttgcgccatggaatgttttagccatt
acttttactaataaggcagctagcgaaatgaaagaacgtgtccaaaagttattaggacca
gcagctgacagtgtttggatgtcaacttttcatgctttatgtgtccgtattttacggcga
gacgcaaaaaaaattggctactctaataatttttcaattgctgattctgcagaacaattg
acactaattaaacgaattgaaaaggatcttaatattaatcctaaaatgtacgatccaaaa
gcaattttaggcgctatttcgaatggaaaaaatgacttacttactccaaaagactttaag
gagcaagcagctagtccgtttgaaaaggtaacagcgcaagtatatagcgaatatcagcat
cgcttaaagcgtgatcaaattatggattttgatgatttaattatgcaaacgctcgtctta
tttaaaaaggataaagaaactttgcattattatcaaaataaattccgctatattttagta
gacgagtatcaggatacaaatgaagcacagtatcaactttgtgttgctttagctgctcaa
tataaaaatatttgcgttgttggggatgcagatcagtcgatctatggttggcgcggagct
aacatggaaaatattcttaattttgagcatgactatcaagatgatgaagttactactatt
aaattagagcaaaactaccgttctactggccatattcttgatgcagctaactcagtaatt
aaaaataatctgaaacgtaaacctaagaaactttggacggataaaggcgctggcgataaa
atcaattattaccgtgctcagagtggaaatgatgaagcactgtttatcatttcaaagatt
aaagaagaaataaaaaaacatcaaagagactacaaggattttgccgttctttatcggaca
aatgctcaatcacgtaacgtcgaagaagccctagttaaagctaatattccgtatcggatt
gttggaggacataagttctacgaccgaaaagaaattaaagatattttggcttatttaaaa
gttgtcgcaaatcctgctgattcaatgagtttcaaccgaattattaatgtaccaaaacgt
ggtttggggccaactacgatggctaagtttaacggttttgctaatgataatgactttaca
gtagaagagactttcaagaatttgagcttagcaccaattacgggtcgcccagctagaacg
ctagctacttttggaacggccttaaaagatgcaatcgaatatagtaagacgcatggtgta
acaggtttaacggaaaaaatattagctgatttcggctacaaagaagctttagaaaatgaa
cacacaattgaagcagatactagattagaaaacttaaatgaatttctgactgttactaag
cgttttgatgataattatgagcccgaagatgaagattcaacagctttaggtgattttatt
tcagagatctcattattaagtgatcaagatgatttagaaaatcaagataaccaagttgca
ttgatgactcttcatgccgctaagggactagagtttccagtggtcttcttggttggaatg
gaagagggactcttcccactttcaagagcagtagaagatccaagtgaacttgaagaagaa
cgtcgactagcatatgtaggaattacacgagctgaaaagaaactctacataaccaatgct
ttttctagaatgatgtatggccgtccgcaacgtaatcaaccatcacgctttattgatgag
attgaagataaggatttagaatttgttaacccaatgccatctaattctgtcatctctgtt
ccctttgctattaatagaaagaaacaagctaactctcatgtttaccctccaaagatgaca
attgaggaggctaagaaagcaactggtgcagttggagctgagaaaaagtcctggaatgtt
ggtgatcaagttacacataaagcatggggaaaaggcgttgtagtcaaagttaacggtact
ggtgaagatatggaattagatattgcctttgctagccaaggagtgaaacgccttttagct
gcctttgcaccgattaaaaagatataa

DBGET integrated database retrieval system