KEGG   Leptospira kmetyi: EFP84_04585
Entry
EFP84_04585       CDS       T05705                                 

Definition
(GenBank) acyl-CoA desaturase
  KO
K00507  stearoyl-CoA desaturase (Delta-9 desaturase) [EC:1.14.19.1]
Organism
lkm  Leptospira kmetyi
Pathway
lkm01040  Biosynthesis of unsaturated fatty acids
lkm01100  Metabolic pathways
lkm01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:lkm00001]
 09100 Metabolism
  09103 Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    EFP84_04585
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:lkm01004]
    EFP84_04585
Enzymes [BR:lkm01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     EFP84_04585
Lipid biosynthesis proteins [BR:lkm01004]
 Desaturase
  First
   EFP84_04585
SSDB
Motif
Pfam: FA_desaturase
Other DBs
NCBI-ProteinID: AYV54863
LinkDB
Position
1:986383..987462
AA seq 359 aa
MQKEKSINWVTTIFLIVTPIVGVAGTVWLEVTRGIPYQTWLLFLFMMFATGIGITAGYHR
LFSHRAYKAALPVRIFFLLFGGAAFQSTVLEWCADHRIHHRHVDKDEDPYAITKGFWHAH
ILWLFQKREYSLTNIPDLWEDKWIVWQHEYYYSISIFMCFFFPGLIGLLWGDFLGGVLVA
GFLRLFINHHFTFFINSLCHFRGTQPFSDKHTAKDNWILALFTYGEGYHNFHHEFQADYR
NGIRFFDYDPSKWLIKGLYHLGLASDLKQIPEEQIFRKKVQMDEKRFLKRMETLQIPFSA
DLETKLQSYKQSLIDRQADFVSKKESSSDKKQVRVAKGEFRSALKTWKQIVSGDLQTLS
NT seq 1080 nt   +upstreamnt  +downstreamnt
atgcaaaaagaaaaatcaatcaattgggtgaccacgatcttcttaatcgtaactccgatc
gtcggagttgctggaaccgtttggctggaggtaacgagaggaattccgtatcagacctgg
ctcttgtttttgtttatgatgtttgcgaccggaatcggaatcaccgcgggctatcataga
ctcttctcccatcgggcgtataaggccgcgcttccggtaagaatttttttcctgctcttc
ggcggagccgcgtttcaaagtaccgttttagaatggtgcgcggatcatagaattcatcac
agacacgtggacaaggacgaggacccgtatgcgatcacgaaaggattttggcacgctcat
atcctttggttgtttcaaaaaagagaatattctttgacgaacatccccgatctttgggaa
gacaagtggatcgtatggcaacacgaatattactattcgatttcgatctttatgtgtttt
ttctttcccggtttgatcggtcttctttggggagattttttaggcggggttttagtcgcg
gggttcttaagactttttatcaatcatcactttacgttcttcatcaactcgctttgtcat
ttccgaggaacccaaccgttttcggacaaacataccgcaaaggacaactggatcttagcg
ttattcacgtacggagaaggatatcataactttcatcacgagttccaagcggattataga
aacggaatccgttttttcgactacgatccgagcaagtggctcatcaaaggtttgtatcat
ctgggtcttgcgtccgatttaaaacaaattccggaagaacagattttccgcaaaaaagtg
cagatggacgaaaaacgttttttgaaaagaatggaaacgttgcagattccattctccgcc
gatctggaaacaaaactgcaatcgtataaacaatccttgatcgatcgtcaggcggatttc
gtttccaaaaaagaatcttccagcgataagaagcaggtgcgcgtcgccaagggagaattc
agatccgctctcaaaacttggaaacaaatcgtttccggagatctgcaaaccctttcttaa

DBGET integrated database retrieval system