KEGG   Lactobacillus kunkeei: APS55_04040Help
Entry
APS55_04040       CDS       T04112                                 

Definition
(GenBank) enoyl-ACP reductase
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
lku  Lactobacillus kunkeei
Pathway
lku00061  Fatty acid biosynthesis
lku00780  Biotin metabolism
lku01100  Metabolic pathways
lku01130  Biosynthesis of antibiotics
lku01212  Fatty acid metabolism
Module
lku_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:lku00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    APS55_04040
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    APS55_04040
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    APS55_04040
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:lku01004]
    APS55_04040
Enzymes [BR:lku01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     APS55_04040
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     APS55_04040
Lipid biosynthesis proteins [BR:lku01004]
 Fatty acid synthase
  Component type
   APS55_04040
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR Enoyl_reductase AdoHcyase_NAD DUF1307
Motif
Other DBs
NCBI-ProteinID: ALJ31446
UniProt: A0A087EN59
LinkDB All DBs
Position
911270..912031
Genome map
AA seq 253 aa AA seqDB search
MSNLLDGKTIVVMGVANKRSIAWGCAKSLMDNGAQVIITYQNERLKRQLDKLVPEGTEMI
ECDVSEDANVEKTFQDIQAKFGNIDGVIHAIAYADKETLEGGVIDVKKDGYNLAQDVSAY
SLISVSRYASRVMNPQGSIATLTYMGSTRAIPSYNMMGVAKAALEANVRYLASDLGPKKI
RVNAISAGAIKTLAVTGIKNHGDLLKESEARTVDGEAVDIHQVGDVATFLMSNLSSGVTG
DLIYADKGVHLLA
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaacttattagatggaaaaacaattgttgttatgggtgttgctaacaaacgtagt
attgcctggggttgtgctaagtcactaatggataacggtgctcaagttatcattacttac
caaaatgaaagattaaagcgtcaattagacaagcttgttcctgaaggaactgaaatgatt
gaatgtgacgtttctgaagatgcaaacgttgaaaagactttccaagacattcaagctaaa
tttggtaacatcgatggtgttattcatgccattgcttatgctgacaaggaaactcttgaa
ggtggcgttattgacgttaagaaagatggttacaacttagctcaagacgtttcagcttac
tcactaatctcagtatcacgttacgcaagtcgtgttatgaatccacaaggtagtattgct
actctaacttacatgggttcaactcgtgctatcccttcatacaacatgatgggtgttgct
aaggctgctctagaagctaacgttagatacctagcttcagacttaggtcctaagaagatc
cgtgttaacgctatctcagctggtgccatcaagactctagctgttactggtatcaagaac
cacggtgacctattgaaggaatcagaagcaagaactgttgacggtgaagctgttgacatc
caccaagttggtgacgttgctacattcctaatgagtaacctatcatcaggtgttactggt
gacttgatttacgctgataagggtgttcatttacttgcttaa

DBGET integrated database retrieval system