KEGG   Lactococcus lactis subsp. lactis Il1403: L00196
Entry
L00196            CDS       T00045                                 

Gene name
trxB2
Definition
(RefSeq) thioredoxin reductase
  KO
K21567  ferredoxin/flavodoxin---NADP+ reductase [EC:1.18.1.2 1.19.1.1]
Organism
lla  Lactococcus lactis subsp. lactis Il1403
Brite
KEGG Orthology (KO) [BR:lla00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    L00196 (trxB2)
Enzymes [BR:lla01000]
 1. Oxidoreductases
  1.18  Acting on iron-sulfur proteins as donors
   1.18.1  With NAD+ or NADP+ as acceptor
    1.18.1.2  ferredoxin---NADP+ reductase
     L00196 (trxB2)
  1.19  Acting on reduced flavodoxin as donor
   1.19.1  With NAD+ or NADP+ as acceptor
    1.19.1.1  flavodoxin---NADP+ reductase
     L00196 (trxB2)
SSDB
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox HI0933_like DAO Thi4 NAD_binding_8 FAD_binding_2 K_oxygenase FAD_oxidored FAD_binding_3 Lycopene_cycl Amino_oxidase GIDA Oxidored_nitro
Other DBs
NCBI-GeneID: 1115307
NCBI-ProteinID: NP_267803
UniProt: Q9CF34
LinkDB
Position
complement(1694827..1695792)
AA seq 321 aa
MQELDLIIVGAGPVGLYAAFYAGMRGLSVAIIESAQVPGGQPQNLYPEKLIYDIAGLPAV
TGADLTKNLLEQLAQISHRLFLGESVQKIEKEEGIFSVTTDKSTRRAKGVLLTTGAGLLK
PRKLGIDNEETLANEGKISYFITSLKEFEGKNVAVFGGGDSALDWSLMLEKVAKNVHLVH
RRTAFRGHEITVDRVMNSNVQVHTPYTFSNLIENELELKKIKSEESLNFSIDKILVNYGF
LTNQVTLAENLEVSRNGRVKADSMMQSNIEGLYVAGDASDYPGKMPLMSVGFGEAVHAIN
AMTKKLEFDHPLRGGHSSSIF
NT seq 966 nt   +upstreamnt  +downstreamnt
atgcaagaattagatttaattattgttggagcaggtcctgttggtctatatgcggctttt
tacgcaggaatgcgcggtttatcagttgcaataattgaatcagcgcaagttccaggtggt
caaccccaaaatctttaccctgaaaaattaatctacgatattgctggcctaccagcagtg
acaggggcagatttgacaaaaaatcttttagaacaactagcacaaatctctcatcgatta
tttcttggggagagcgttcaaaaaattgaaaaagaagagggaattttttctgtaactact
gataaatcaaccagaagagccaaaggcgttttgttgacgactggtgccggccttttgaaa
cctcgaaagttaggaattgataacgaagaaactttagccaatgaaggaaaaatatcttac
tttatcacttctctaaaagagtttgagggaaaaaatgttgcggtttttggtggaggagat
tcggctttagattggtcattaatgcttgaaaaagtagctaaaaatgttcatttggttcat
agaagaactgcttttcgtggtcatgaaattacagttgaccgagtgatgaattctaatgtt
caagttcatacgccttatactttttcaaatttgattgaaaatgaattagaattaaaaaaa
ataaaatcagaagaaagcttgaacttttcgattgataaaattttggttaattatggtttt
ttaacaaatcaagtgactttagctgaaaacttagaagtcagtcgtaatggtcgcgttaag
gccgattcaatgatgcaatccaatattgagggactttatgtcgcaggagacgcaagtgat
tatccgggaaaaatgcccttgatgtccgttggttttggtgaagcagtccatgcgattaat
gccatgacgaaaaaacttgaatttgaccacccacttagagggggacattcttcatctatt
ttttaa

DBGET integrated database retrieval system