KEGG   Lactococcus lactis subsp. lactis Il1403: L0036Help
Entry
L0036             CDS       T00045                                 

Gene name
pdhD
Definition
(RefSeq) dihydrolipoamide dehydrogenase
  KO
K00382  dihydrolipoamide dehydrogenase [EC:1.8.1.4]
Organism
lla  Lactococcus lactis subsp. lactis Il1403
Pathway
lla00010  Glycolysis / Gluconeogenesis
lla00020  Citrate cycle (TCA cycle)
lla00260  Glycine, serine and threonine metabolism
lla00280  Valine, leucine and isoleucine degradation
lla00310  Lysine degradation
lla00380  Tryptophan metabolism
lla00620  Pyruvate metabolism
lla00630  Glyoxylate and dicarboxylate metabolism
lla00640  Propanoate metabolism
lla01100  Metabolic pathways
lla01110  Biosynthesis of secondary metabolites
lla01120  Microbial metabolism in diverse environments
lla01130  Biosynthesis of antibiotics
lla01200  Carbon metabolism
Module
lla_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:lla00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    L0036 (pdhD)
   00020 Citrate cycle (TCA cycle)
    L0036 (pdhD)
   00620 Pyruvate metabolism
    L0036 (pdhD)
   00630 Glyoxylate and dicarboxylate metabolism
    L0036 (pdhD)
   00640 Propanoate metabolism
    L0036 (pdhD)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    L0036 (pdhD)
   00280 Valine, leucine and isoleucine degradation
    L0036 (pdhD)
   00310 Lysine degradation
    L0036 (pdhD)
   00380 Tryptophan metabolism
    L0036 (pdhD)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lla04147]
    L0036 (pdhD)
Enzymes [BR:lla01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.4  dihydrolipoyl dehydrogenase
     L0036 (pdhD)
Exosome [BR:lla04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   L0036 (pdhD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_dim Pyr_redox FAD_oxidored FAD_binding_2 HI0933_like NAD_binding_8 GIDA Pyr_redox_3 FAD_binding_3 AlaDh_PNT_C Thi4 DAO
Motif
Other DBs
NCBI-GeneID: 1113662
NCBI-ProteinID: NP_266215
UniProt: Q9CJD8
LinkDB All DBs
Position
complement(58971..60389)
Genome map
AA seq 472 aa AA seqDB search
MVVGAQATEVDLVVIGSGPGGYVAAIRAAELGKKVTIIEKDNVGGVCLNIGCIPSKALIN
IGHHYQESLEEEKGENPFGLSVGNVKLNWESAQKWKQDKVVNQLTGGVKMLLKKHKVDVI
QGTAEFIDNNTINVEQEDGFQLLQFNDVIISTGSRPIEIPSFPFGGRIIDSTGALSLPEV
PKHLIIVGGGVIGSELGGAYRMLGSKITIVEGLDHILNGFDKEMSDIIANRVKSAGSEIF
TSAMAKSATQTDKDVTLTFEVDGKEQTVTGDYLLVSVGRRPNTDLIGLNNTDVKLTDRGL
IEVDDSYATNVPHIYAIGDVVPGPMLAHKASFQAKVAAAAIAGAEDDVDLHVALPAVAYT
TTELATVGETPESVKDRKDVKISKFPFAANGRAISMNDTTGFLRLITETKEGALIGAQIV
GPGASDLISGLSLAIENGLTSKDISLTIQPHPTLGEAIMDTAELADGLPIHV
NT seq 1419 nt NT seq  +upstreamnt  +downstreamnt
atggttgttggtgcacaagcaacagaagttgatttggttgttattggttcaggccctggt
ggttatgttgcagccatccgtgcggctgaacttggtaaaaaagttacaattattgaaaaa
gataatgttggtggggtttgtttaaatattggttgtatcccatcaaaagcattgattaat
attggtcatcattaccaagaatctttggaggaagaaaaaggagaaaatccttttggtctt
tctgtcggaaatgttaaattaaactgggaatctgcccaaaaatggaaacaagataaagtt
gtcaaccagttgacaggtggtgttaaaatgctacttaaaaaacacaaagttgacgtgatt
caaggaactgcagaatttattgataacaatacaataaatgttgaacaagaagatgggttc
caacttttgcaatttaatgatgtgattatctcaactggttcacgtcctatcgaaattcct
tctttcccatttggtggtcgcattattgactctactggtgctttgtcacttccagaagtt
cctaaacatttgattattgttgggggaggagttattggttctgagcttggtggagcatac
cgtatgctcggttctaagattacaattgttgaaggtttggaccacattttaaacgggttt
gataaagaaatgtctgatatcattgctaatcgcgttaaatctgctggttctgaaatcttt
acttcagcaatggctaaatcagctactcaaactgataaagatgtaactttgacttttgag
gttgacggaaaagaacaaacggtgactggtgattacttactcgtttctgttggacgtcgt
ccaaatactgatttaatcggcttgaacaacactgatgttaaattgactgaccgtggtttg
attgaagttgacgattcttatgcaactaatgttcctcacatttatgcaatcggtgatgtg
gttcctggtccaatgctcgctcacaaagcttctttccaagctaaagttgctgctgctgcg
attgctggagctgaggacgacgtggacttacacgttgctttgcctgctgtagcttataca
acaactgaattagcaacagttggagaaacgcctgaatcagttaaagaccgtaaagatgtt
aaaatttctaagttcccatttgctgcaaatggccgtgccatttcaatgaatgatacgact
ggtttcttacgtttgattactgaaactaaagaaggggccttaatcggtgctcaaatcgtt
ggccctggtgcatctgacttgatttctggtttatcactagcgattgaaaatggattgact
tctaaagacatttcattgactatccaacctcacccaacacttggtgaagcgattatggat
acagctgaattggctgatggcttaccaattcacgtttaa

DBGET integrated database retrieval system