KEGG   Lactococcus lactis subsp. lactis Il1403: L132777
Entry
L132777           CDS       T00045                                 

Gene name
pfs
Definition
(RefSeq) 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase
  KO
K01243  adenosylhomocysteine nucleosidase [EC:3.2.2.9]
Organism
lla  Lactococcus lactis subsp. lactis Il1403
Pathway
lla00270  Cysteine and methionine metabolism
lla01100  Metabolic pathways
lla01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:lla00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    L132777 (pfs)
Enzymes [BR:lla01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.9  adenosylhomocysteine nucleosidase
     L132777 (pfs)
SSDB
Motif
Pfam: PNP_UDP_1 DUF5811
Other DBs
NCBI-GeneID: 1115545
NCBI-ProteinID: NP_268037
LinkDB
Position
complement(1949415..1950095)
AA seq 226 aa
MKIGIICAMDEEIRILVENLENAEKHTRHGLVFHTGSIGRHEVVLVQSGIGKVMSALAVG
FLVDIFDVDAIINTGSAGAVAQGLAIGDVVVADKLAYHDVDVTAFGYAYGQMAQQPLYFE
SSKYFVSELKKVLENVHVGLITSSDSFISSSSKIAEIKEHFPDVLAVEMEGASIAQAATA
LGKPFVIIRAMSDTADHDANVNFDKFIIEAGKKSAEGLIRLLKEMV
NT seq 681 nt   +upstreamnt  +downstreamnt
atgaaaataggaattatttgtgcgatggatgaagaaattcgcatacttgttgaaaactta
gaaaatgcagaaaaacatactcgtcatggtttagtttttcatacaggttcaattggccgg
catgaagtggtccttgtccaatctggaattggtaaagtgatgtctgctttggcagttggt
tttttggttgacatttttgatgtcgacgccattatcaatactggatcagcgggagcagtt
gctcaaggtttagcaattggtgatgttgtagttgctgataaacttgcttatcatgatgtt
gatgttactgcttttggttatgcttatggccaaatggctcaacaacctttatattttgaa
tcaagtaaatattttgtttctgaattgaaaaaagttttagaaaatgtgcatgttggattg
attactagttcggatagttttatcagtagctctagtaaaattgctgagattaaagagcat
tttccagatgttttagccgttgaaatggaaggggcttcaattgctcaagcagcaacagca
cttggaaaaccatttgtaattattcgtgcgatgtctgatactgctgaccatgatgctaat
gttaattttgataaatttattattgaagcaggaaaaaaatcagctgagggcttgattcgt
ttactcaaagaaatggtataa

DBGET integrated database retrieval system