KEGG   Lactococcus lactis subsp. lactis Il1403: L162604Help
Entry
L162604           CDS       T00045                                 

Gene name
aspC
Definition
(RefSeq) aminotransferase AlaT
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
lla  Lactococcus lactis subsp. lactis Il1403
Pathway
lla00220  Arginine biosynthesis
lla00250  Alanine, aspartate and glutamate metabolism
lla00290  Valine, leucine and isoleucine biosynthesis
lla01100  Metabolic pathways
lla01110  Biosynthesis of secondary metabolites
lla01130  Biosynthesis of antibiotics
lla01210  2-Oxocarboxylic acid metabolism
lla01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:lla00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    L162604 (aspC)
   00290 Valine, leucine and isoleucine biosynthesis
    L162604 (aspC)
   00220 Arginine biosynthesis
    L162604 (aspC)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:lla01007]
    L162604 (aspC)
Enzymes [BR:lla01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     L162604 (aspC)
    2.6.1.66  valine---pyruvate transaminase
     L162604 (aspC)
Amino acid related enzymes [BR:lla01007]
 Aminotransferase (transaminase)
  Class I
   L162604 (aspC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_5 Beta_elim_lyase
Motif
Other DBs
NCBI-GeneID: 1113768
NCBI-ProteinID: NP_266316
UniProt: Q9CJ46
LinkDB All DBs
Position
162666..163880
Genome map
AA seq 404 aa AA seqDB search
MRKFEKSHKLDNVSYDIRGPVLDEAQRMRANGEKILRLNTGNPAEFGFLAPDEVISDLIQ
HAVDSEGYSDSKGIFSARKAIMQYCQLKGFPNLDINDIFTGNGVSELIVMAMQGLLDTGD
EVLIPMPDYPLWTASVSLAGGTAVHYLCDEQAGWFPDIDDIRSKITSNTKAIVLINPNNP
TGALYSKDLLLEIVQVARENNLIIFSDEIYDRLVMDGAVHVPIASLAPDLFVVTMNGLSK
SHRIAGFRVGWMVLSGEKSHVKGYIEGLNMLASMRLCSNVLAQSVVQTSLGGTQSVDKLL
LPGGRVYEQREFIYKAINDIPGLSAVKPQAAFYIFPKIDREMYKIDNDEQFVLDFLKQEK
ILLVHGRGFNWKEPDHFRIVYLPRVDELAEIQEKMERFLWQYRK
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaatttgaaaaatcgcataaacttgataatgtcagctatgatattcgtggtcca
gtattggatgaagcacaaagaatgcgagccaatggtgaaaaaattcttcgattgaataca
ggaaatccagctgaatttggctttcttgctcctgatgaagtcattagtgacttgattcaa
catgctgtggatagcgaaggatattcagattctaaagggattttctcggctcgtaaagcg
attatgcaatactgtcagctcaagggttttcctaatcttgatatcaatgatattttcaca
ggtaatggggtttctgaattgattgttatggccatgcagggacttttggacacaggggat
gaggttttgattcctatgcctgattatccactttggacggcttctgtcagcttagctgga
ggaacagctgttcattacctctgtgatgaacaggctggttggttccctgacattgatgat
attcgctcaaaaatcacaagtaatacaaaagccattgttttgattaatcctaataatcca
acgggtgcgctgtattctaaagatttattgcttgaaattgttcaagtggctagagaaaat
aatttaattattttctctgacgaaatttatgaccgattggttatggatggagcagttcat
gttccgattgctagcttggcaccagatctttttgtggtcacaatgaatggcctctcaaaa
tcacaccgcattgcgggattccgtgtggggtggatggttttgtcaggtgaaaaatcacat
gtcaagggttatattgaaggtttgaatatgctggcttcaatgcgactttgttccaatgtt
ttagctcaatcagtcgtacaaacttcacttggtggcactcaatcggttgataaattgctg
ttgccgggtggacgagtttatgaacaaagagaattcatttataaagccatcaatgatatt
ccaggattatctgcggtcaaacctcaagcagctttctatattttccctaaaattgacaga
gaaatgtataaaattgataatgatgaacaatttgtcttggactttttgaagcaggaaaaa
atcctgcttgttcatggtcgaggatttaattggaaagagccagaccatttccgaattgtt
tatctgcctcgtgtggacgaattagcggaaatacaagaaaaaatggaacgtttcctttgg
caatatcgtaaataa

DBGET integrated database retrieval system