KEGG   Lactococcus lactis subsp. lactis Il1403: L178227
Entry
L178227           CDS       T00045                                 

Gene name
noxD
Definition
(RefSeq) NADH oxidase
Organism
lla  Lactococcus lactis subsp. lactis Il1403
SSDB
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox DAO Pyr_redox_dim HI0933_like K_oxygenase NAD_binding_8 3HCDH_N NAD_binding_9 Amino_oxidase FAD_oxidored GIDA AlaDh_PNT_C FAD_binding_3 NAD_Gly3P_dh_N
Other DBs
NCBI-GeneID: 1115803
NCBI-ProteinID: NP_268283
UniProt: Q9CDT5
LinkDB
Position
complement(2194782..2196113)
AA seq 443 aa
MKIVIVGSSHAGICAGLRALEEYPEAEITLYDKRNQVSFVSQGIISYLAGQKSVLNQSSY
SSVEELKAAGLNMQMETVVEEIDTKNKRLFYRRVNSKKTKLALYDKLIFATGSYPAMTSV
PFDKKSKLYFLKSMDDAIKTDEFLKTAKNIAVIGGGMTGVEVARIAQERGIQTTLIHRNK
NLLNDYLDEPASHLLESWMNAEGTRLLLNTEVTEIGFDEENTIIQTANGQKIPVDGVIFT
IGFRPNSYLLNQQVELGDSGAVIVDEYMQTSCPDVFAVGDVSTTYVNLLEKSYYLPHASD
AVRDGEIAAINLLAPRQKINSSQGTYHVPMNNLVMAMTGITIRQAVDAGYDADAVHLLNE
HLDGYSPSNIWMIYERRTHQILGLQCIGKTSDMAEYVNIFSLAIQQKLKIEDIEFTDFYF
EHGYKDPRGLNRILARLVRENER
NT seq 1332 nt   +upstreamnt  +downstreamnt
atgaaaattgttattgttggaagctcccacgccggaatttgtgccggattacgggcgctt
gaagaatacccagaagccgaaattacgctttatgataagcgtaatcaggtttcttttgtt
tctcaaggaattatttcttatctggcgggtcaaaaatctgtccttaatcaatctagttat
tcttcggtagaagaactaaaagctgctggtttaaacatgcaaatggaaacggtggttgaa
gagattgataccaaaaataaacggctattttatcggagagtcaattccaaaaagacgaaa
ctcgctctctatgataaattgatttttgctacgggttcttatccggcaatgacctctgtt
ccttttgataaaaaaagcaaactttactttttaaaaagtatggatgatgcaataaaaaca
gatgaatttctgaaaacagccaaaaatattgcagtaattggtggtggaatgaccggagtt
gaagttgctcggattgcccaagaaagaggaattcagacaacactcattcatcgcaataaa
aatcttttaaacgattatcttgatgaaccagcaagtcatttattggaaagttggatgaat
gcagagggaacgcgtcttctattaaatacagaagtgacagaaattgggtttgacgaagaa
aatacaattattcaaacagcaaatggtcagaaaattcctgttgatggagtaatctttacg
attggttttcggcctaattcttatcttctgaatcaacaagttgagttaggagatagcgga
gcggttattgttgatgaatacatgcaaacctcttgtccagatgtttttgctgtcggagat
gtttcaacgacttatgttaatttgttggaaaaaagctattatctgccacatgcttcggat
gctgttcgcgatggtgaaattgcggcgattaatttacttgctcctcgccaaaaaattaat
agtagtcagggaacttatcatgttccaatgaataatttagtgatggctatgactgggatt
acaataagacaggcagttgatgctggttatgatgcagatgcggttcatttactaaatgaa
cacttagacggatattcaccaagtaatatttggatgatttatgagagacgcactcatcaa
attcttggtttacaatgtattggaaaaacgagcgatatggcagagtacgtcaatattttc
tcacttgcgattcaacagaaattaaaaattgaggatattgagttcacagacttttatttt
gaacatggctacaaagaccctcggggtctcaatcgcatattagctcgactagtaagggag
aatgaaaggtag

DBGET integrated database retrieval system