KEGG   Lactococcus lactis subsp. lactis Il1403: L56208
Entry
L56208            CDS       T00045                                 

Gene name
ycfF
Definition
(RefSeq) hypothetical protein
Organism
lla  Lactococcus lactis subsp. lactis Il1403
SSDB
Motif
Pfam: HI0933_like FAD_binding_2 GIDA FAD_oxidored Pyr_redox_2 NAD_binding_8 DAO FAD_binding_3 Thi4 AlaDh_PNT_C Pyr_redox_3 Pyr_redox 3HCDH_N NAD_binding_9 Lycopene_cycl FbpA UDPG_MGDP_dh_N NAD_binding_7 Trp_halogenase Ribosomal_S13
Other DBs
NCBI-GeneID: 1113868
NCBI-ProteinID: NP_266414
UniProt: Q9CIU8
LinkDB
Position
complement(256200..257471)
AA seq 423 aa
MTKSAKTFDVIVVGAGPSGMMAAISAAQNGAKVALIDKNKKVGKKLLMTGGGRCNVTNAR
SVDEILTNVPGNGRFLHSAFSQFSNLDIIEFFESNGVKLKEEDHGRMFPITDKSKTIVDA
LFNKILSLHVSYFPSQAVDKLLIENGAVIGLETDSESFLSPTIILSTGGRAYPSTGSTGD
GYRLARSAGHSISQLYATESALISDEPFILDKSLQGISLREIKLSVLNSKGKAIISHQHD
LLFTHFGISGPAAMRCSSFINQLLAKGEKMVTVSLDQFPEKKLGSLKNELTSLSKTDKSI
KNAFSGLTQERMLLFILEKAGIDPSLSAKTLSEQQIDKIASLFKNWQITISKTLPIEKSF
VTGGGVSLKEINPKSMESKQTQGLFMTGELLDINGYTGGYNITCAFVTGFVAGKHAAQIA
SYF
NT seq 1272 nt   +upstreamnt  +downstreamnt
atgacaaaatcagctaaaacatttgacgttattgttgttggcgcaggcccttctggaatg
atggctgccatctcagccgcgcaaaatggagcaaaagttgctcttattgataaaaataaa
aaagtcggaaaaaaattattaatgacaggtggcggacgctgtaatgtgacaaatgcccgt
tctgttgacgaaatattaacaaatgttcctggaaatggtcgttttcttcattcagccttt
tctcaattttccaaccttgatattatcgaattttttgaaagcaatggtgttaaattaaaa
gaagaagaccacgggcgcatgttccctataaccgacaaatcaaaaacaattgttgatgcc
ctctttaataaaattttgagtctccatgtttcttattttccaagccaagcagttgataag
cttctcattgaaaacggagcggtaattggtcttgaaacggatagcgagagctttttaagc
cctacaattatcctctcaacaggcggacgcgcttatccttccacaggttcaactggtgat
ggctatcgtttagcacgctcagcagggcatagtatttcacaactctatgccactgaatct
gcccttatttctgacgaaccattcattttagacaaaagtcttcaaggcatttccctacgc
gaaatcaaactctcagtactcaattctaagggaaaagcaatcatctctcatcagcatgat
ttattatttacgcatttcggaatttctggtccagctgctatgcgttgttcaagtttcatt
aaccaacttcttgctaaaggtgaaaaaatggtcacagtcagcttagaccaattccccgaa
aaaaagttgggctctttgaaaaatgaactgactagcctttctaaaacagataaatcaatt
aaaaatgccttctcaggattgacccaagaacgtatgcttctatttatccttgaaaaagct
ggaattgaccctagtctttctgccaagacgctatctgagcagcaaattgataaaatcgct
agtcttttcaaaaattggcaaatcacaattagcaaaactttaccaattgagaaatctttt
gtaacaggtggcggtgtttctctcaaagaaataaatcctaaaagtatggagagtaaacaa
acccaaggtttattcatgaccggtgaacttttagatattaatggatacactggcggttat
aatattacctgcgcctttgtgacaggttttgttgctggaaaacacgctgcccaaatcgca
tcttatttctaa

DBGET integrated database retrieval system