KEGG   Lactococcus lactis subsp. lactis Il1403: L77437Help
Entry
L77437            CDS       T00045                                 

Gene name
amyL
Definition
(RefSeq) alpha-amylase
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
lla  Lactococcus lactis subsp. lactis Il1403
Pathway
lla00500  Starch and sucrose metabolism
lla01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lla00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    L77437 (amyL)
Enzymes [BR:lla01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     L77437 (amyL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Glyco_hydro_70
Motif
Other DBs
NCBI-GeneID: 1114900
NCBI-ProteinID: NP_267407
UniProt: Q9CG59
LinkDB All DBs
Position
1277443..1278918
Genome map
AA seq 491 aa AA seqDB search
MKTILQAFEWYLPSDSQHWNNIKENIPDLGKLGFSGLWLPPASKAASGVEDVGYGTYDLF
DLGEFDQKGTIPTKYGTKDEYLDLINTLHHNNIEVYADIVFNHMMGADETETIEADIKAE
DNHLHNIENNKTVEVWTKFTFPGRQGKYDNYIWTWHNFTGIDYDERKNQEEILEFEGHEW
DENVDSENNNFDYLMGADLDFSVSETVEQLEKWGHWFSEMTKIDGFRLDAIKHIDFKYFD
KWLEQRAKQLDRKLFIVGEYWSDDLGKLEYYLEQSSDRIQLFDVPLHFNMKEASSTNGEF
DMRTLFDHTLTASQPELSVTFVDNHDTQEGQALQSWIPAWFKEHAYSLILLRKKETPTVF
WGDLYGIPSHNVNPVGDNLRTMIALRKDSEFLRENDYFDHPDIIGWTNILKIDNKEYGLS
CILTNKNGGSKYMIIDKAYAGKVYIDLFGRHEIPITLDQNGGAEFYVNDGSVSVWVDKEI
VSKIDQMNFQN
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacaatccttcaagcttttgaatggtatttaccctcagattctcagcactggaat
aatataaaagagaatattcctgacttgggaaagttaggattttcaggattgtggttacct
ccagcttccaaggcagcttctggagttgaagatgttggttatgggacctatgatttattc
gacttaggggaatttgatcaaaaagggacaattcctacaaaatatgggactaaagatgaa
tatcttgatttaattaatacactacaccacaacaatattgaagtgtatgcggatatcgtt
tttaatcacatgatgggtgctgatgaaacagaaactattgaagctgatattaaagcagaa
gataatcatcttcataacatcgaaaataataaaactgttgaagtttggaccaaatttaca
tttccaggaagacaaggaaaatacgacaattatatatggacctggcacaactttacggga
attgattatgatgaaaggaaaaatcaagaagaaattcttgaatttgaaggacatgaatgg
gatgagaatgtagattcagagaataataattttgattatttaatgggggctgatcttgat
tttagtgtttcggaaacggtagaacaacttgaaaaatggggacattggttttcagaaatg
acaaaaattgatggttttcgattagatgcaattaaacatattgatttcaaatattttgat
aaatggcttgagcagagagcaaagcaattggatagaaaactttttattgttggcgagtac
tggtctgatgatcttggcaaattagagtattatctagaacaatccagtgatagaatacaa
ttatttgatgtaccactacattttaatatgaaagaagcctcttcaaccaatggagaattt
gatatgcgtactctttttgatcacacactcactgccagccagccagaactctcggtcact
tttgttgataaccatgatactcaagaaggacaggctcttcaatcttggattccagcttgg
tttaaagagcacgcttatagcttaattttacttcgaaaaaaagaaactcctactgtcttt
tggggagatttatatggaataccctcacataatgttaatcctgtaggtgataacttaaga
actatgatagcattacgtaaggactctgagtttttaagggaaaatgattattttgatcat
cctgatattattggatggacaaatattttaaaaatagataataaggaatatggattatca
tgtattttaactaataaaaatggtggctcaaaatatatgataattgataaggcgtatgca
ggtaaagtttatatagatttatttggaagacacgaaatacctattacgctggatcaaaat
ggtggagctgaattttatgtcaatgatggaagtgtttcggtttgggtagataaggaaatt
gtttcaaaaattgatcaaatgaactttcaaaactaa

DBGET integrated database retrieval system