KEGG   Lactococcus lactis subsp. cremoris SK11: LACR_0167Help
Entry
LACR_0167         CDS       T00420                                 

Definition
(GenBank) L-aspartate aminotransferase apoenzyme
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
llc  Lactococcus lactis subsp. cremoris SK11
Pathway
llc00220  Arginine biosynthesis
llc00250  Alanine, aspartate and glutamate metabolism
llc00290  Valine, leucine and isoleucine biosynthesis
llc01100  Metabolic pathways
llc01110  Biosynthesis of secondary metabolites
llc01130  Biosynthesis of antibiotics
llc01210  2-Oxocarboxylic acid metabolism
llc01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:llc00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    LACR_0167
   00290 Valine, leucine and isoleucine biosynthesis
    LACR_0167
   00220 Arginine biosynthesis
    LACR_0167
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:llc01007]
    LACR_0167
Enzymes [BR:llc01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     LACR_0167
    2.6.1.66  valine---pyruvate transaminase
     LACR_0167
Amino acid related enzymes [BR:llc01007]
 Aminotransferase (transaminase)
  Class I
   LACR_0167
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_5 Beta_elim_lyase
Motif
Other DBs
NCBI-ProteinID: ABJ71786
UniProt: Q032T6
LinkDB All DBs
Position
152479..153693
Genome map
AA seq 404 aa AA seqDB search
MRKFEKSHKLDNVSYDIRGPVLDEAQRMRANGEKILRLNTGNPAEFGFLAPDEVISDLIQ
HAVDSEGYSDSKGIFSARKAIMQYCQLKGFPNLDINDIFTGNGVSELIVMAMQGLLDTGD
EVLIPMPDYPLWTASVSLAGGTAVHYLCDEQAGWFPDIDDIRSKITSNTKAIVLINPNNP
TGALYSKDLLLEIVQVARENNLIIFSDEIYDRLVMDGAVHVPIASLAPDLFVVTMNGLSK
SHRIAGFRVGWMVLSGEKSHVKGYIEGLNMLASMRLCSNVLAQSVVQTSLGGTQSVDKLL
LPGGRVYEQREFIYKAINDIPGLSAVKPQAAFYIFPKIDREMYKIDNDEQFVLDFLKQEK
ILLVHGRGFNWKDPDHFRIVYLPRVDELAEIQEKMERFLWQYRK
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgagaaagtttgaaaaatcgcataaacttgataatgtcagctatgatattcgtggtcca
gtgcttgatgaagcacagcgtatgcgagccaatggtgaaaaaattcttcggttgaataca
ggaaatccagcggaatttggttttcttgccccagacgaagtgattagcgatttgattcag
catgctgtggatagcgaaggttattcagattctaaaggtattttctcggctcgtaaggcg
attatgcaatactgtcaacttaaaggcttccctaatctggatatcaatgacattttcact
ggtaacggtgtttctgaattaatcgttatggctatgcaaggccttttggatacgggtgat
gaggttttgatccctatgcctgattatccgctctggacggcttctgtcagcttagctggg
ggaacagcggttcactatctctgcgatgaacaagctggatggtttccggatattgatgat
attcgctcaaaaattactagtaatactaaagccattgttttaattaatcctaataatcca
acgggtgcgctgtattctaaagatttattacttgaaattgtccaagtggctagagaaaat
aatttaattatcttttcggatgagatttatgaccgtttggtcatggacggcgctgttcat
gttccgattgccagcttagcacctgacctttttgtggtcacaatgaatggactttccaag
tcacatcgtattgctggatttcgtgtgggctggatggttctgtcaggtgagaaatcgcat
gtcaaaggctatatcgaaggcttgaacatgctcgcttcaatgagactttgttcaaatgtt
ttagctcagtctgttgtgcaaacctcacttggtgggactcaatctgttgataagctgctt
ttgccagggggacgagtttatgaacaaagagaattcatttataaagccattaatgatatt
ccaggattgtctgccgtgaagccacaagctgctttctatattttccctaaaattgacaga
gaaatgtataaaattgataatgatgaacaatttgttttagactttttaaaacaggaaaag
atacttcttgttcatggtcgaggattcaattggaaagatcctgatcattttcggattgtc
tatctgcctcgtgtagatgaactggcggaaatacaggaaaaaatggaacgctttttatgg
cagtatcgtaaataa

DBGET integrated database retrieval system