KEGG   Lactococcus lactis subsp. cremoris SK11: LACR_0384Help
Entry
LACR_0384         CDS       T00420                                 

Definition
(GenBank) Alkyl hydroperoxide reductase, large subunit
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
llc  Lactococcus lactis subsp. cremoris SK11
Brite
KEGG Orthology (KO) [BR:llc00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    LACR_0384
Enzymes [BR:llc01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     LACR_0384
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA FAD_oxidored Thioredoxin_3 FAD_binding_2 HI0933_like DAO Thi4 FAD_binding_3 AlaDh_PNT_C NAD_binding_8 K_oxygenase Glutaredoxin Lycopene_cycl
Motif
Other DBs
NCBI-ProteinID: ABJ71991
UniProt: Q031Y1
LinkDB All DBs
Position
348688..350214
Genome map
AA seq 508 aa AA seqDB search
MILDENLRSQLLPYMDLLENPIILKVDANDSENGQKINEFTDELASLSDLISKEKTNLNH
KPAFSIEREGVSGVAFSGLPLGHELNSLVLALVQVSGRPPRIEQELIEQIKAIKTSLHFD
TYVSLTCHNCPDVVQALNTMTILNPNISHTMIEGGMFQEEVEAKGIMAVPAVFKNAEEFH
SGRASLEELLEKITGPESSDSFAEKEPYDVLVVGGGPAGASAAIYAARKGIRTGLIAERF
GGQPLETLGIENLIGTPYIEGVQLGRQLEEHVKKYPVDLMNLQKAVKLEKKDLIEVSLEN
GATLKSKAVILSTGARWRDLGIPGEQRFKNKGVAYCPHCDGPLFSGKDVAVIGGGNSGIE
AAIDLAGLVNHVTVLEFLPELKADKILQKKLASLTNVTVLTNVETKEILGDEQVTGLNYQ
VRGSKETIHLELAGVFVLIGLVPNTQWLEGTIDLTDRHEIVTDKVGATNIPGVFAAGDCT
DTVYKQIIVSMGSGATASLGAFDYLIRN
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
atgattttagatgaaaatctgcgttctcagttactgccgtatatggatttattagaaaat
ccaattattttaaaagtggacgcaaacgatagtgaaaatggacaaaaaataaatgaattt
acagatgaactggcaagtttatcagacttgatttcaaaagagaaaacaaatctgaatcat
aaaccggctttttcaattgaaagagaaggtgtttcaggggttgctttttcaggtcttcct
ttgggtcatgagttaaattcattggttttggcccttgtgcaagtgagtggtcgaccacca
cgtattgaacaagaattaattgaacaaattaaggctattaaaacttcacttcattttgat
acttatgtcagtttaacttgtcataattgtccagatgtggttcaagctttaaatacaatg
accattctcaaccctaacattagtcataccatgattgagggaggcatgttccaagaagaa
gtagaagcaaaaggaattatggctgttcctgctgtctttaaaaatgccgaagaatttcat
agtggacgagcaagtcttgaagaattgttggaaaaaattacaggtccagaaagttcggat
agtttcgcagaaaaagaaccttatgatgttttggtagtaggaggggggccagctggtgcg
agtgcagctatttatgcggcacgtaagggaatcaggacaggattgattgccgaacgcttt
ggaggccaacctttagaaactttagggattgaaaatctgattggaacaccctatatagag
ggtgttcagcttgggcgtcagcttgaagaacacgtaaaaaaatatccagtagatttgatg
aatctgcaaaaagcagttaaacttgagaaaaaagatttaattgaagtaagtcttgaaaat
ggtgcaaccttgaagagtaaagctgttattctctcaactggcgctcgttggcgggattta
ggaatcccaggagaacaacgctttaagaataaaggagtggcttattgtcctcattgtgat
ggtccgcttttctctggtaaagatgtggcagttattggtggaggaaattcagggattgaa
gcagcgatagacttagctggtttggtcaaccatgtcactgttcttgaatttttaccagaa
cttaaagcagataaaatcttacaaaaaaaacttgctagtctaactaatgttactgttttg
accaatgtggaaactaaagagattttaggagatgagcaagtcacggggttgaattatcaa
gttcgaggctctaaagaaacgattcatttagagcttgccggtgtctttgttttgattggt
ttagttcccaatactcagtggttggaagggacaattgatttgacagatcgtcatgaaatt
gtgactgataaggttggagcaacaaatattccgggtgtctttgcagcaggagattgcaca
gatactgtttataaacaaattattgtgtcaatgggaagtggagcgactgcttccttaggt
gcctttgattatttgataagaaattaa

DBGET integrated database retrieval system