KEGG   Lactococcus lactis subsp. cremoris SK11: LACR_1457Help
Entry
LACR_1457         CDS       T00420                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
llc  Lactococcus lactis subsp. cremoris SK11
Pathway
llc00010  Glycolysis / Gluconeogenesis
llc00030  Pentose phosphate pathway
llc00051  Fructose and mannose metabolism
llc00052  Galactose metabolism
llc00680  Methane metabolism
llc01100  Metabolic pathways
llc01110  Biosynthesis of secondary metabolites
llc01120  Microbial metabolism in diverse environments
llc01130  Biosynthesis of antibiotics
llc01200  Carbon metabolism
llc01230  Biosynthesis of amino acids
llc03018  RNA degradation
Module
llc_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:llc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LACR_1457
   00030 Pentose phosphate pathway
    LACR_1457
   00051 Fructose and mannose metabolism
    LACR_1457
   00052 Galactose metabolism
    LACR_1457
  09102 Energy metabolism
   00680 Methane metabolism
    LACR_1457
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    LACR_1457
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:llc01009]
    LACR_1457
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:llc03019]
    LACR_1457
Enzymes [BR:llc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     LACR_1457
Protein phosphatases and associated proteins [BR:llc01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     LACR_1457
Messenger RNA biogenesis [BR:llc03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     LACR_1457
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase
Motif
Other DBs
NCBI-ProteinID: ABJ72967
UniProt: Q02YK5
LinkDB All DBs
Position
complement(1379409..1380431)
Genome map
AA seq 340 aa AA seqDB search
MKRIAVLTSGGDAPGMNAAIRAVVRKAISEGIEVYGINHGYAGMVAGDIFPLTSASVGDK
IGRGGTFLYSARYPEFAQVEGQLAGIEQLKKFGIEGVVVIGGDGSYHGAMRLTEHGFPAV
GLPGTIDNDIVGTDFTIGFDTAVSTVVDALDKIRDTSSSHNRTFVVEVMGRNAGDIALNA
GIAAGADDICIPEKEFKFENVVNNINKGYEKGKNHHIIVLAEGVMTGEEFATKLKEAGYK
GDLRVSVLGHIQRGGSPTARDRVLASRMGARAVELLRDGIGGVAVGIRNEELVESPILGT
AEEGALFSLTTEGGIKVNNPHKAGLELYRLNSALNNLNLN
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgcattgcagttttgacttctggtggtgatgccccagggatgaatgcggctatt
cgtgcagttgttcgcaaagcaatttctgaaggtatcgaagtttacggtatcaatcacgga
tatgcgggcatggttgcgggagacattttcccgcttacgtcagcttcagttggtgataaa
atcggtcgtggtggtacattcttgtactcagcacgttacccagaatttgctcaagtagaa
ggacaacttgctgggattgagcaacttaaaaaattcggtatcgaaggtgtcgttgtaatc
ggtggtgacggatcttaccatggagctatgcgtcttacagaacatggtttcccagctgtt
ggacttccaggcacaatcgataacgatatcgtaggaactgattttacaattggttttgat
acagcggtttcgacagtcgtagatgccttggataaaatccgtgatacttcatcatcacat
aaccgtactttcgttgtagaagtaatgggacgtaatgctggagatatcgctttgaatgct
ggtatcgctgctggtgcagatgatatttgtattccagaaaaagaatttaagtttgaaaac
gtagttaacaacattaacaaaggctacgaaaaaggtaaaaatcaccacatcatcgttctt
gctgaaggcgttatgactggtgaagaatttgctacaaaacttaaagaagctggttataaa
ggagaccttcgtgtttctgttcttggacacatccaacgtggtggttcaccaacagctcgt
gaccgtgttcttgcttcacgtatgggagctcgtgccgttgaattgcttcgtgatggaatc
ggtggcgtagccgttggtatccgtaatgaagaacttgtagaaagtccaattctcggaact
gctgaagaaggagcactctttagtttgactactgaaggtggcatcaaagtaaacaacccg
cataaagcaggtcttgaactttaccgtcttaactcagcactcaacaatcttaaccttaac
taa

DBGET integrated database retrieval system