KEGG   Lactococcus lactis subsp. cremoris SK11: LACR_1486Help
Entry
LACR_1486         CDS       T00420                                 

Definition
(GenBank) Glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
llc  Lactococcus lactis subsp. cremoris SK11
Pathway
llc00564  Glycerophospholipid metabolism
llc01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:llc00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    LACR_1486
Enzymes [BR:llc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     LACR_1486
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored GIDA Pyr_redox_3 Pyr_redox_2 HI0933_like Pyr_redox NAD_binding_8 FAD_binding_3 Lycopene_cycl
Motif
Other DBs
NCBI-ProteinID: ABJ72995
UniProt: Q02YH7
LinkDB All DBs
Position
1408725..1410302
Genome map
AA seq 525 aa AA seqDB search
MSISRQKNIEYLKANPDDWDFIIIGGGATGLGVAVDAASRGYKTVLVEQSDFAKSTSSRS
TKLVHGGVRYLAQGDVSLVREALHERGRLARNGPHLVKNQKFIIANYKAWEQPFYSIGMK
MYDALAGKLNIGKSKIYSKKKVAEAIPQIKHEHLVGGVMYYDGQFDDARMAINLMQTATE
QGALLVNYVKVTELVKTNSKVSSVKLHDELSGESFELHGKSIINATGIFVDQIMSMDTKE
HKPSVRPSQGVHLIVDGSFLGGQDAIMVPKTSDGRVLFCVPWHNKVILGMTDTPLTEFVL
EPRPLEEEIDFILETAGQYLEKKPERKDVLTAYAGLRPLAAPKEGDGEKTKEISRSHKLF
TSESGLVTITGGKWTTYRQMAEETVDLAIKTSKLPEKKCITRTLKIHGAKETTERERQNW
LYVYGSDKGKILALQNEDSSLALPLHPKYEFTGSEVIWAVREEMAQTLDDVLARRIRALF
LDARIAKEMAPKVAQLMAKEMGKDEAWEKEQVESFLALADGYILK
NT seq 1578 nt NT seq  +upstreamnt  +downstreamnt
atgtctatctctcgtcaaaaaaatattgaatatttaaaagcaaatcccgatgattgggac
ttcattattatcggtggtggagcaaccggacttggagttgcggttgatgccgcatcacgc
ggttataaaacagttctagttgaacaaagtgactttgcaaaatcaacttcaagccgctcg
acaaaacttgttcacggtggcgttcgctaccttgctcaaggagatgtcagccttgttcgt
gaagcattacatgaaagaggtcgccttgctcgcaacggtccccatcttgtaaaaaatcaa
aaatttatcattgccaattacaaagcttgggagcaaccattttatagcatcggaatgaaa
atgtatgatgctttggcaggtaaattgaatattggaaaatcaaaaatttattctaagaaa
aaagttgctgaagcaattcctcaaatcaaacatgaacatctcgtcggaggagtcatgtat
tatgacggacaattcgatgatgctagaatggctatcaaccttatgcaaactgccactgaa
caaggtgcgctactagttaattatgtcaaagtgactgagcttgttaaaacgaactcaaaa
gtatcttctgttaaacttcatgatgaactttctggcgaatcatttgaacttcacggaaaa
tccatcatcaacgctacaggaatctttgttgaccaaattatgtcaatggataccaaagaa
cacaagccctctgttcgtccttcacaaggcgtccacctcattgttgacggctcatttctc
ggtggtcaagatgccattatggttccaaaaacttctgacggtcgtgtcttgttctgtgtc
ccttggcacaataaagtaatcttaggaatgacagatacacctcttacagaattcgtttta
gaacctcgaccccttgaagaagaaattgatttcatcttagaaactgctggtcaatattta
gaaaagaaacccgaacgtaaagatgttttaactgcttatgctggtttacgtccacttgcc
gctcccaaagaaggtgatggcgaaaaaacgaaagaaatttcaagaagtcataaactcttc
acctctgaatcaggactggtcacaattactgggggaaaatggacaacttatcgccaaatg
gccgaagaaactgttgatttagcaatcaaaacctctaaacttcctgaaaaaaaatgtatc
accagaacattgaaaatacatggggccaaagaaacaactgaaagagaacgtcaaaactgg
ctctatgtttacggttctgataaaggaaagattttagctctccaaaatgaagactcttct
ttagccttacctcttcacccaaaatacgaatttacaggttctgaagtcatctgggctgtc
cgtgaagaaatggctcaaactctagatgatgttctcgctcgtcggattcgtgcacttttc
cttgatgcaagaattgccaaagaaatggctcccaaagtcgcccaactgatggcgaaagaa
atgggtaaagatgaagcatgggaaaaagaacaagttgagagcttccttgctttagctgat
ggttatattttaaaataa

DBGET integrated database retrieval system