KEGG   Lactococcus lactis subsp. cremoris SK11: LACR_1732Help
Entry
LACR_1732         CDS       T00420                                 

Definition
(GenBank) Glycerol uptake facilitator related permease (Major Intrinsic Protein Family)
  KO
K02440  glycerol uptake facilitator protein
Organism
llc  Lactococcus lactis subsp. cremoris SK11
Brite
KEGG Orthology (KO) [BR:llc00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:llc02000]
    LACR_1732
Transporters [BR:llc02000]
 Other transporters
  Aquaporins and small neutral solute transporters [TC:1.A.8]
   Aquaglyceroporins or glycerol-uptake facilitators
    LACR_1732
Ion channels [BR:llc04040]
 Non-ion channels
  Aquaglyceroporins or glycerol-uptake facilitators
   LACR_1732
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MIP
Motif
Other DBs
NCBI-ProteinID: ABJ73228
UniProt: Q02XU4
LinkDB All DBs
Position
complement(1640355..1641218)
Genome map
AA seq 287 aa AA seqDB search
MDVSWMTKYIAEGLGTMLLVLLGNGTIAGVTLKGSKNEGMGGLAIAWGYGIAMLVPVLAF
ANVSGAHINPAITLGLASAGLFPWAHVAQYILAQLIGAIIGQLLVVAIYKEYFAKTNDGA
ISLGAFATTNALDDGSNRGKAIFNGFVNEVIGMFVFVFGILSFTTNFFGSESIKWMTSYA
QQQGADITSSGTLSQIWASVSGASSSKMVGALAIGLMFVGLVTAFGGPTGAALNPARDLG
PRIVYSFLPQSVVGENKDAKWWYAWVPVVATIVGAVIAATVFKLMFK
NT seq 864 nt NT seq  +upstreamnt  +downstreamnt
atggatgtttcatggatgacaaaatatattgctgagggattgggaactatgcttctcgtt
ttgcttggtaatggtacaattgcgggagtaacactcaaaggctctaaaaatgagggcatg
ggtggccttgcaatcgcttggggatacggaattgcgatgctagttcctgttcttgctttt
gcaaatgtttcaggggctcatattaacccagcaattacacttggacttgcttcagctggt
ctattcccttgggctcatgttgcgcaatatatcttggctcaacttattggtgcaattatt
ggtcagttactcgtcgtagcgatttacaaagaatactttgctaaaactaatgacggagca
atttctttaggcgcatttgccacaactaacgctttggatgatggttcaaatcgaggaaaa
gcaattttcaacggttttgtcaatgaagtaatcggaatgtttgtatttgttttcggaatt
ctcagttttacaacgaacttctttggctcagaatcaatcaaatggatgacaagttacgct
caacaacaaggtgcagatatcacttctagtggtacacttagccaaatttgggcttctgtt
tcaggcgcttcatcatctaaaatggttggtgcccttgccattggtttaatgtttgttggt
ttggttacagcatttggtggaccaactggtgcagcattgaatccagcacgtgaccttggt
cctcgtattgtttatagcttcttgccacaatcagttgttggtgaaaataaagacgctaaa
tggtggtatgcttgggttccagtggttgccacaatcgttggtgcagtaattgcagctaca
gtatttaaactcatgtttaaataa

DBGET integrated database retrieval system