KEGG   Lactococcus lactis subsp. cremoris SK11: LACR_2088Help
Entry
LACR_2088         CDS       T00420                                 

Definition
(GenBank) Cell wall-associated hydrolase
Organism
llc  Lactococcus lactis subsp. cremoris SK11
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase_5 Holin_SPP1 PG_binding_1 NLPC_P60 PG_binding_3 FAA_hydrolase
Motif
Other DBs
NCBI-ProteinID: ABJ73565
UniProt: Q02WV7
LinkDB All DBs
Position
complement(1979811..1980878)
Genome map
AA seq 355 aa AA seqDB search
MKTIDKGTLTRTILLWLAILNQVLTALGKNPLPLDDNTVSTLITAVFALWAWWKNNDFTH
AAKKGTELTKSLKNGDSVQVVKASDADHEFTEGGRMMSSIENMIAWMQARKGKVTYSMTS
RMGPTSYDCSSSVFFAMIAGGFLSVGSMGNTETLFGMSGTKLKEISRGEVQRGDIFISGT
PGGSAGSDGHTGIFLSNGSFIHCSYTHNRIAIDTNDAYMSTRLPHHFYRIVGSGSANTDD
KPQMVTLNLDGQFGNATAKRLQEYFDTAGKDGVISHQYKQTFNQNIYAAQFDSSLTGSNV
VKALQRFLGIGQDGLFGQATIKALQKHLGTTQDGIISPVSDSVRELQRRLNANKL
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacaattgataaaggaacactcacacgtacaatcttactttggttggcaatttta
aaccaagtattgacagcgcttggtaagaatccacttccattagatgataatactgtcagt
acattaattactgctgtatttgctctttgggcttggtggaagaataatgacttcactcat
gcagctaaaaaaggaactgaacttacaaaaagtttgaaaaatggtgatagcgttcaagtg
gttaaagcttctgacgctgaccacgaattcacagaaggggggcgaatgatgtcaagtatt
gaaaatatgattgcttggatgcaagcacgaaaaggcaaagttacttactcaatgacttca
cgaatgggtccaacaagttatgattgcagctcgtcagtattctttgccatgattgctggt
ggttttctgtcagtaggttcaatgggaaatactgaaactttatttggaatgtctggcaca
aaactcaaagaaatcagccgtggagaagtgcaacgtggggacatttttatctcgggcact
ccaggaggttctgctggatctgatggacacacaggtattttcctaagcaatggttcattc
attcactgttcttacactcacaatagaattgcgattgatacgaacgatgcatacatgagt
acacgcttaccacatcacttttatcgaattgttggttcaggttcagcaaatactgatgac
aagccacaaatggttactctaaatcttgatggtcaatttggaaatgcgaccgctaaacga
ttgcaagaatactttgatactgctggtaaagacggagtaatcagtcaccagtacaaacaa
acctttaatcaaaatatttatgctgctcagtttgattcatcactgactggttcaaacgtg
gttaaagcattgcaaagatttttaggaattggacaagacggactgtttgggcaagctacg
attaaagcactacaaaaacatcttggaacaacacaagacggaataattagcccagtatct
gattctgtcagagaattacaacgtcgattaaatgcgaataaactataa

DBGET integrated database retrieval system