KEGG   Lactococcus lactis subsp. lactis KLDS 4.0325: P620_01115Help
Entry
P620_01115        CDS       T02882                                 

Definition
(GenBank) pyridoxal phosphate-dependent aminotransferase
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
lld  Lactococcus lactis subsp. lactis KLDS 4.0325
Pathway
lld00220  Arginine biosynthesis
lld00250  Alanine, aspartate and glutamate metabolism
lld00290  Valine, leucine and isoleucine biosynthesis
lld01100  Metabolic pathways
lld01110  Biosynthesis of secondary metabolites
lld01130  Biosynthesis of antibiotics
lld01210  2-Oxocarboxylic acid metabolism
lld01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:lld00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    P620_01115
   00290 Valine, leucine and isoleucine biosynthesis
    P620_01115
   00220 Arginine biosynthesis
    P620_01115
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:lld01007]
    P620_01115
Enzymes [BR:lld01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     P620_01115
    2.6.1.66  valine---pyruvate transaminase
     P620_01115
Amino acid related enzymes [BR:lld01007]
 Aminotransferase (transaminase)
  Class I
   P620_01115
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_5 Beta_elim_lyase
Motif
Other DBs
NCBI-ProteinID: AGY43506
UniProt: U5PIL5
LinkDB All DBs
Position
198828..200042
Genome map
AA seq 404 aa AA seqDB search
MRKFEKSHKLDNVSYDIRGPVLDEAQRMRANGEKILRLNTGNPAEFGFLAPDEVISDLIQ
HAVDSEGYSDSKGIFSARKAIMQYCQLKGFPNLDINDIFTGNGVSELIVMAMQGLLDTGD
EVLIPMPDYPLWTASVSLAGGTAVHYLCDEQAGWFPDIDDIRSKITSNTKAIVLINPNNP
TGALYSKDLLLEIVQVARENNLIIFSDEIYDRLVMDGAVHVPIASLAPDLFVVTMNGLSK
SHRIAGFRVGWMVLSGEKSHVKGYIEGLNMLASMRLCSNVLAQSVVQTSLGGTQSVDKLL
LPGGRVYEQREFIYKAINDIPGLSAVKPQAAFYIFPKIDREMYKIDNDEQFVLDFLKQEK
ILLVHGRGFNWKEPDHFRIVYLPRVDELAEIQEKMERFLWQYRK
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaatttgaaaaatcgcataaacttgataatgtcagctatgatattcgtggtcca
gtattggatgaagcacaaagaatgcgagccaatggtgaaaaaattcttcgattgaataca
ggaaatccagctgaatttggctttcttgctcctgatgaagtcattagtgacttgattcaa
catgctgtggatagcgaaggatattcagattctaaagggattttctcggctcgtaaagcg
attatgcaatactgtcagctcaagggttttcctaatcttgatatcaatgatattttcaca
ggtaatggggtttctgaattgattgttatggccatgcagggacttttggacacaggggat
gaggttttgattcctatgcctgattatccactttggacggcttctgtcagcttagctgga
ggaacagctgttcattacctctgtgatgaacaggctggttggttccctgacattgatgat
attcgctcaaaaatcacaagtaatacaaaagccattgttttgattaatcctaataatcca
acgggtgcgctgtattctaaagatttattgcttgaaattgttcaagtggctagagaaaat
aatttaattattttctctgacgaaatttatgaccgattggttatggatggagcagttcat
gttccgattgctagcttggcaccagatctttttgtggtcacaatgaatggcctctcaaaa
tcacaccgcattgcgggattccgtgtggggtggatggttttgtcaggtgaaaaatcacat
gtcaagggttatattgaaggtttgaatatgctggcttcaatgcgactttgttccaatgtt
ttagctcaatcagtcgtacaaacttcacttggtggcactcaatcggttgataaattgctg
ttgccgggtggacgagtttatgaacaaagagaattcatttataaagccatcaatgatatt
ccaggattatctgcggtcaaacctcaagcagctttctatattttccctaaaattgacaga
gaaatgtataaaattgataatgatgaacaatttgtcttggactttttgaagcaggaaaaa
atcctgcttgttcatggtcgaggatttaattggaaagagccagaccatttccgaattgtt
tatctgcctcgtgtggacgaattagcggaaatacaagaaaaaatggaacgtttcctttgg
caatatcgtaaataa

DBGET integrated database retrieval system