KEGG   Lactococcus lactis subsp. lactis KLDS 4.0325: P620_06195Help
Entry
P620_06195        CDS       T02882                                 

Definition
(GenBank) TIGR01457 family HAD-type hydrolase
  KO
K01101  4-nitrophenyl phosphatase [EC:3.1.3.41]
Organism
lld  Lactococcus lactis subsp. lactis KLDS 4.0325
Pathway
lld00627  Aminobenzoate degradation
lld01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:lld00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    P620_06195
Enzymes [BR:lld01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.41  4-nitrophenylphosphatase
     P620_06195
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hydrolase_6 Hydrolase_like HAD_2 Hydrolase
Motif
Other DBs
NCBI-ProteinID: AGY44212
LinkDB All DBs
Position
1159352..1160125
Genome map
AA seq 257 aa AA seqDB search
MTNKKYGGYLIDLDGTIYLGNKRIPAGENFIHRLQEAKIPYLLVTNNTTKTPRVVQRRLS
QQFNIDTPLETIYTASLATVDYMNDLGLEKTVYIIGEDGLKEAIYEAGYKKDRENPAYVV
VALDTDLTYEMLVLATLAIHKGAKFIGTNPDLNLPNERGLTPGAGALIKMLEAATRVEAT
IIGKPEAIIANKAVEKLGLPKSGLLMVGDNYLTDIHTGINNGIDSLLVTTGFTRAEEVPN
LPVPPTYVVASLDEWEV
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgacaaataaaaaatatggtggttacttaattgaccttgatgggacaatttacttggga
aataagcgtattcctgcaggcgagaatttcattcatcggctacaagaggctaaaatacct
tatcttttggtcacaaataacacaacaaaaacaccgcgcgtggtacaacgccgtttgagt
caacaatttaatattgacactccattggaaacgatttatactgcaagtcttgctactgtt
gattatatgaatgatttaggcttagaaaaaacagtttatatcattggagaagatggtctt
aaagaagcgatttatgaggcaggttacaaaaaagatcgtgagaatccagcttacgttgtg
gtcgctttagatactgatttaacttatgaaatgcttgtccttgctactctggcaattcat
aaaggagctaaatttatcggaacaaatccagatttgaatttgccaaacgaacgtggtttg
actcctggagctggagcgctgataaaaatgcttgaagcggcaacacgagttgaagcaacc
attattggtaagccagaagctattatagccaataaagcggtcgaaaaattagggcttcct
aaatctggtttattaatggttggcgataattatctgacagatattcatacgggcattaat
aacggaattgatagcttgcttgtcacaactggatttacaagagctgaagaagtaccaaat
cttccagttcctccgacttatgtagtagctagtttagatgagtgggaagtttga

DBGET integrated database retrieval system