KEGG   Lactococcus lactis subsp. lactis KLDS 4.0325: P620_08035Help
Entry
P620_08035        CDS       T02882                                 

Definition
(GenBank) anthranilate synthase component I
  KO
K01657  anthranilate synthase component I [EC:4.1.3.27]
Organism
lld  Lactococcus lactis subsp. lactis KLDS 4.0325
Pathway
lld00400  Phenylalanine, tyrosine and tryptophan biosynthesis
lld01100  Metabolic pathways
lld01110  Biosynthesis of secondary metabolites
lld01130  Biosynthesis of antibiotics
lld01230  Biosynthesis of amino acids
lld02024  Quorum sensing
Module
lld_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:lld00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    P620_08035
  09110 Biosynthesis of other secondary metabolites
   00405 Phenazine biosynthesis
    P620_08035
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    P620_08035
Enzymes [BR:lld01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.27  anthranilate synthase
     P620_08035
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Chorismate_bind Anth_synt_I_N
Motif
Other DBs
NCBI-ProteinID: AGY44394
LinkDB All DBs
Position
complement(1569633..1571003)
Genome map
AA seq 456 aa AA seqDB search
MRKIKEISADTMTPISVYLRLKGKNKVILESIPRENDQSRFSIIALNPVKHIKFTDGILS
VNDEIISDENPMEFLEKLVCQPESTDENLDLPFTSGAIGYAGFDTYGIFEGIQPELKDSI
GTPDMYFMLYESALIFDHKREKLIFIEDNTYSQRSEKELQNALSANIESLSLLTEAENEL
TELSKLNFVSNMSQELFEEKVAKAKELIRNGDMFQVVLSQRLTADFTDNPFNYYRKLRVE
NPSSYMYFMEFDNFHVIGSSPERLVAVHGIQVSTNPIAGTRKRGQTEFEDQALIEDLESD
PKEVAEHKMLVDLGRNDIGKISKYGSIEVPVFMKVEKYRYVMHITSEVTGELRPEFTAMD
ALRATLPAGTLSGAPKHRAYQRIYEFETQKRGIYGGAIGYLTKNGNCDFAIAIRTMVLKD
KKAHVQAGAGIVYDSVPEHEYQETLNKAQGLLKVGQ
NT seq 1371 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaaattaaagaaatttcagcagacaccatgaccccgatttcggtttatcttcgc
ctgaaagggaaaaataaagtgattttagaatccattcccagagaaaatgaccaatcacgt
ttttcaattattgcgttgaatcctgtgaagcacatcaaatttactgacggaattttaagc
gtaaatgacgaaatcattagcgatgaaaatccaatggaatttctggaaaaattagtttgt
cagccagaaagtactgacgaaaatttagacttgccttttacaagtggagcgattggatat
gctggatttgatacctatggtatttttgaaggcattcaacctgaactgaaagattcgatt
ggaacaccagatatgtattttatgttatacgaatcagctctaatttttgaccacaaacga
gaaaaactgatttttattgaagacaatacttacagtcagcgttcagaaaaagagttacaa
aacgcgctgtcagcaaatattgagtcattatctttactgacagaagcagaaaatgaactg
acagaattaagtaaactgaatttcgtcagcaatatgtctcaagaactttttgaagaaaaa
gttgctaaagcaaaggaacttatcagaaatggtgacatgttccaagttgttttatcacaa
cgtttaacagccgattttactgacaacccttttaattattacagaaagcttcgggttgaa
aatccgtcatcgtatatgtactttatggaattcgataattttcatgtcattggcagctca
ccagagcgtttggttgcagttcatggaattcaagtttcaaccaatccaattgccggaaca
agaaaacgcgggcaaactgaatttgaagaccaagctcttattgaagatttagaaagtgat
cccaaagaagtcgctgaacacaaaatgcttgttgatttaggacgaaatgatattggtaaa
atttccaaatatggttcaatcgaagttcctgttttcatgaaagttgagaaatatcgctac
gtcatgcatattacaagtgaagtgaccggcgagcttcgtcctgaatttacagctatggat
gccttacgcgccacattgccagcggggacgctatcaggagcaccgaagcatcgagcctac
caaagaatttatgaatttgaaacgcaaaaacgaggaatttatggtggagctatcggttat
ctaacgaaaaatggaaattgcgattttgcaattgccattcggacaatggtcttgaaagac
aagaaagcacatgttcaagcaggagccggaattgtttacgattcagtacccgaacatgaa
tatcaagaaaccttaaacaaagcccaaggcttattgaaagttggtcaataa

DBGET integrated database retrieval system