KEGG   Leuconostoc lactis: BCR17_00110Help
Entry
BCR17_00110       CDS       T04460                                 

Definition
(GenBank) MFS transporter permease
Organism
llf  Leuconostoc lactis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MFS_1 Sugar_tr MFS_1_like Folate_carrier MFS_2 MFS_3
Motif
Other DBs
NCBI-ProteinID: ANY10904
UniProt: A0A1B1ZYQ9
LinkDB All DBs
Position
complement(22094..23308)
Genome map
AA seq 404 aa AA seqDB search
MIQQHDRLMPHTKDAAKDRHVGQTQRLFQQDFLLLMVINFMVMTAVTAQMGTLPLYVTQL
GGNAMMSGLVIGIWGLAALVARVPVGKMIDRFGRKPLIVIGLLVLVVDFGLLIFSQSLLV
LILLRAFQGIGNGTQSTAVATLVADKLPPRQLSIGLGYFSISQTLPAAVGPAIGLLIVNH
WGFQAMFYFSLGLVVVALGLTVLVRDTYNLKTQQATAATAPVGILVLLAQVSIWAPSLVV
FIAAFANAAVAAFLVQFGFEKGLPLTLVGLSFTVQALVGVLARIWFAKLYLYFHTLTLVG
SSIVMIASAYVCIAFSPGIGGFLIAGGLIGLGFALLMPLMNAVVLRDVLPVQRGRATAIF
SSGTDVAYGMGAIIWGIFASYFGYFAVYCVAAILVATTLSLVMR
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgatacagcagcatgatcggctgatgccgcataccaaagacgccgccaaagaccgccat
gttggtcagacgcagcgtctttttcaacaagattttctgttgttaatggtgattaatttt
atggtcatgaccgctgtgaccgcacaaatggggacgttaccattatatgtgacgcaatta
ggtggcaatgcgatgatgtcgggcttggtgattgggatttgggggctagcggccttagta
gcgcgtgtgccagtgggtaaaatgattgatcgctttgggcgcaagccattaatcgtgatt
gggttgctcgttttagtggtcgattttggcctactgatttttagtcaatcattacttgtt
ttgattttactgcgtgcgtttcaaggtattggtaatggtactcaaagcaccgcagttgcg
acgttggtcgctgacaaattaccgccacgacagctatccattgggttaggctacttcagt
atttcacaaaccttaccagcagcagttgggccagcaattggcctcttaatcgtcaatcat
tggggatttcaggcgatgttttatttcagtctgggtttggttgttgtggcactagggtta
acggttttggtgcgtgacacgtataatctcaaaacgcagcaagcgactgcggcaacggct
ccagttgggattttggtattgcttgcacaagtgagtatttgggcgccaagtttggttgtt
tttattgctgctttcgccaacgctgccgtggccgcctttttagtccaatttgggtttgaa
aaagggttgcccttgacgctagttggtttaagttttactgtgcaagcgctggttggtgtt
ttagcacggatttggtttgctaagttgtatctgtattttcacacgctgaccttagtaggt
agtagtattgtgatgattgccagtgcgtatgtatgcattgcgtttagtccaggcattggg
ggatttttgatcgccggcggattaattggccttggctttgcgctgttgatgcccttgatg
aatgccgtcgtactacgggatgtcttaccagtgcagcgtggtcgtgcgaccgctattttt
tcatccggaacggacgtggcctatggtatgggggccattatatgggggatttttgccagt
tattttggctattttgcggtgtattgtgtcgctgcgatattggttgccacgacgttaagc
cttgtcatgcgctag

DBGET integrated database retrieval system