KEGG   Leuconostoc lactis: BCR17_03115Help
Entry
BCR17_03115       CDS       T04460                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
llf  Leuconostoc lactis
Pathway
llf00473  D-Alanine metabolism
llf00550  Peptidoglycan biosynthesis
llf01100  Metabolic pathways
llf01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:llf00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    BCR17_03115
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BCR17_03115
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    BCR17_03115
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:llf01011]
    BCR17_03115
Enzymes [BR:llf01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     BCR17_03115
Peptidoglycan biosynthesis and degradation proteins [BR:llf01011]
 Precursor biosynthesis
  Amino acid ligase
   BCR17_03115
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N CPSase_L_D2 ATP-grasp ATPgrasp_ST
Motif
Other DBs
NCBI-ProteinID: ANY11450
UniProt: A0A1B2A0G4
LinkDB All DBs
Position
complement(641842..642975)
Genome map
AA seq 377 aa AA seqDB search
MTKKHVALLFGGNSSEHDVSKRSAQNYYQAIEASGKYDITVFAIAQNGYFLDPESSKRVL
ALEDEQPIVDAFMAKVDTKDPLARISALREAGDFDIFFPVVHGNLGEDGTLQGLFRLLNK
PFVGAPLRGHAVSFDKAMTKELLTVNNIRNTNYVVLDEKTAQDWTWDKVVATFGDVVFVK
AANQGSSVGISRATTAEEFAAALDDSFQYDYKVLVEQAVKGPRELEVGVIGNDEPLVSEI
GAHAVPNQGDGDGWYDYNNKFVDNSAVEFEIPAKLPEAVTQEVKDMALKAYKVLNLRGEA
RMDFLLDENDVPYLGEPNTLPGFTNMSLFKRLWDYSDIDNVALVEKMIAYGFEEFEKNAK
LSYQFVTLGEEKIGKFN
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaaaaacacgttgccctattatttggtggaaactcttctgaacatgatgtgtca
aagcgttccgcccaaaactactatcaagcgattgaagcgagtggcaagtacgatattacc
gtatttgccattgcgcaaaatggctatttcctagatcctgaaagctcaaaacgcgtgttg
gccttagaagacgaacagccaattgttgatgctttcatggctaaagttgatacgaaggat
ccgttggcgcgcattagtgctttgcgtgaagcaggagattttgatattttcttcccagtc
gtgcatggtaatcttggcgaagatggcacactacaaggcctctttcgacttttgaataag
ccatttgttggtgcgccactgcgtggtcatgcggtcagctttgataaggctatgacgaaa
gaattgctaacggttaacaatatccgtaataccaattacgtcgttttggatgaaaaaaca
gcgcaagattggacttgggataaagttgtcgcaacatttggtgatgttgtgttcgtgaag
gcggcaaaccaagggtcatcagtcggcatttcccgcgccacaacagctgaggaatttgca
gctgcgttagacgattctttccaatatgactacaaagtcttggtggaacaagcagtcaag
ggcccacgcgaacttgaagttggtgtgatcggtaatgatgaaccattggtctcagaaatt
ggcgcccatgccgtaccaaatcagggtgatggcgatggttggtatgattacaacaacaag
tttgtggataactctgccgttgaatttgaaatcccagcaaaattgccagaagctgtcaca
caagaagtaaaagacatggctttgaaagcttataaggttttgaacttgcgtggtgaagcg
cgaatggactttttgctagatgaaaatgatgtcccttatttgggcgaacctaacacgttg
ccaggctttacaaacatgtcattgtttaagcgcttgtgggattactcagatattgacaat
gtggcacttgttgaaaagatgattgcctatggttttgaagaattcgagaagaatgccaag
ttaagttatcaatttgtcacattaggtgaagaaaaaatagggaagtttaattaa

DBGET integrated database retrieval system