KEGG   Legionella lansingensis: 44548918_01040Help
Entry
44548918_01040    CDS       T05543                                 

Gene name
glpA
Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
llg  Legionella lansingensis
Pathway
llg00564  Glycerophospholipid metabolism
llg01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:llg00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    44548918_01040 (glpA)
Enzymes [BR:llg01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     44548918_01040 (glpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored GIDA NAD_binding_8 Pyr_redox_2 HI0933_like 3HCDH_N Lycopene_cycl
Motif
Other DBs
NCBI-ProteinID: SNV49733
LinkDB All DBs
Position
1:complement(1130284..1131795)
Genome map
AA seq 503 aa AA seqDB search
MEQVFDVAVIGGGINGCGTAADAALRGLSVILLEKDDLASKTSSSSSKLIHGGLRYLEHY
DFRLVKKALDERQNLLRLAPHLVHPIPFVLPYQENMRPAWLLRTGLFLYDNLSRKNKLPR
SKFILRKKSSTYFSPLQEQLRKGFLFYDCTTDDSRLTITNALQAKDHGAIICNYTKITTA
NVVNGIWHLDITNQEGRKGCVKAKAVINASGPWVEPMNRLLNIPDKFKMSLVKGSHLVVH
KLYEGKHAYLLQHKDQRIVFIVPYQGYTMIGTTDVAFNGSLDEVHISAEEVDYLRNLVNS
YLRCEIQKEDIIYTWSGVRPLIAADGELKTLSRDYSYSYNASPAPSVTIYGGKITTYRQL
ASEVVDELKTVFPYLKESQSNDIVLPGSELNGMSYKDYLIYAREKYHWLTNEIKEHYLAS
YGTRTELLLADCSQMSHLGQDFSNGLYQIEVDYLCREEWAQNCEDILWRRTKKGLNFGSE
NIEILTDYLSSKSLLINSLKIEQ
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atggaacaggtttttgacgtggccgtgataggcggaggcatcaatggctgtggtacagct
gccgatgctgcgctgcgtggtttgtcagtcatccttttggaaaaagatgaccttgcttct
aaaacctcatccagtagcagtaaattaattcatggtggattacgctatcttgaacactac
gattttcggttggtcaaaaaagcgttggatgagcgtcagaatttgttacggttggctccc
catctcgtgcaccctatacctttcgtgctaccctaccaggaaaacatgcgcccagcttgg
ttattacgaacaggattgttcctctacgataatttgagccgcaaaaataaattaccgcga
agtaaattcatcttgcgaaaaaaaagctcaacctatttttctcctctgcaagaacaattg
agaaaaggatttctcttttatgattgtacgactgatgattccagattaacaattacaaat
gcgcttcaggcaaaggatcatggtgcaattatttgcaattataccaagatcacaacagct
aacgttgtgaatgggatctggcatttggatattacaaatcaagaaggtcgaaaaggttgc
gtcaaggcaaaagcagttattaatgcctcaggcccctgggtagaacccatgaatcggcta
ttaaatattcctgataaattcaaaatgtctctggtgaagggaagccatctggttgtgcat
aaactgtacgaggggaagcatgcatatctgctgcaacataaggatcaaaggattgtattc
attgtgccttaccaaggttataccatgataggaacaaccgatgtagcctttaatggctcc
ttggacgaggttcatatctcagcggaagaagttgactatctacgtaacttggtgaacagt
taccttagatgcgagatccaaaaagaggatattatttatacttggagtggtgtaagacca
ttgatcgcagcagatggagaactcaaaaccttaagccgagattactcttattcttacaat
gcatcaccagcaccatcggtaaccatttatgggggaaaaattactacttatcgccaactt
gcttcggaagttgtcgatgagttaaaaaccgttttcccttacctcaaagaatcgcagagt
aatgacattgtattgccaggctcagagcttaatggcatgtcttataaagattatttgatc
tacgcaagagaaaaataccactggctcacaaatgagattaaagagcattatcttgcaagt
tatggaacacgtactgaattgctgttagctgattgcagccaaatgtctcatctaggccag
gatttcagcaatggattataccaaatagaagtagattacctctgtcgtgaagaatgggcg
caaaattgtgaggatattctatggcgacggacgaaaaaaggcttaaattttggttcagaa
aatattgagattcttaccgattacctgtcctctaagagcttgttaattaattcgctaaaa
atagaacaatag

DBGET integrated database retrieval system