KEGG   Legionella lansingensis: 44548918_01399Help
Entry
44548918_01399    CDS       T05543                                 

Definition
(GenBank) glucoamylase
  KO
K01178  glucoamylase [EC:3.2.1.3]
Organism
llg  Legionella lansingensis
Pathway
llg00500  Starch and sucrose metabolism
llg01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:llg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    44548918_01399
Enzymes [BR:llg01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     44548918_01399
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_15
Motif
Other DBs
NCBI-ProteinID: SNV50843
LinkDB All DBs
Position
1:complement(1523609..1524889)
Genome map
AA seq 426 aa AA seqDB search
MKRILMVFFFLFSTTSMATVFSPAEVEILKQNFLANITDVGAVIASPSRYYPDYYYDWVR
DSAIAMNLIETWYEKDRSPEDKARLFNYVYWVEKTQQQIDTIPGQDILGEPKFYLDGRVY
DGAWGRPQNDGPALRALTLTRFANSLLKTNEAGYVRKHLYGGGLDSKTMGAIKRDLEYVA
HHWQDRNYDLWEEVYGDHFFTAMVQRKALIEGAKLARGLGEPSAAIYYESQAELINDRLQ
QHVDKTNAIIQATLPPHPGPQKTLELDSAVMLAILLARTEDTPFSPQNKYIQNTAAALKQ
QFKMLYPINDKHHQALLFGRYPGDTYDGYRNDSIGNPWFILTATMAEYYYTLAAMLPHSL
AYQNAIRSYVEEGDSYLKLIKLYAPNLNMSEQINLNTGIQQGAISLTWSYVAVLRAIGAR
EKVTVH
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgaaacggattttaatggtcttcttttttcttttttcaaccacatcgatggcaaccgtc
tttagccctgccgaagtagagattttaaagcaaaactttctcgccaatatcaccgatgtg
ggagctgtgattgcttctccttcgcgatattatcctgattattattacgattgggtacgt
gattctgctatcgctatgaatcttatcgaaacatggtacgaaaaagacagatcccctgaa
gataaagctagactgtttaattatgtttattgggtggaaaaaactcagcagcaaatcgat
accattccaggacaagatattttaggtgagccgaaattttatctggatggacgtgtatat
gatggagcttggggacgtccccaaaatgatggacctgctcttagagcactaaccttaacc
cgttttgcaaactcacttctcaaaacaaacgaagccggctatgtccgcaagcatctctac
ggtggtggtttagattcaaaaacgatgggagcgattaaacgcgatctcgaatacgttgct
catcattggcaagatagaaattacgatttgtgggaagaggtttatggagatcactttttt
actgccatggtccaaagaaaagcgttgattgaaggagcaaaattagctcgaggcttaggt
gagccatctgccgccatttattatgaaagccaagccgagttaatcaacgatcgtctgcaa
cagcatgttgataaaaccaatgcaatcattcaggcgaccttgccccctcatccgggcccg
caaaaaaccttggaattggattctgccgtgatgctagcgatattattagcccgcacggaa
gataccccttttagccctcaaaataaatatatacaaaatactgccgctgctttaaaacaa
caattcaaaatgctctatcccattaatgacaagcatcatcaagccttgctgtttggacgt
tatcctggtgatacttatgatggttatcgtaacgatagtataggcaacccttggtttatt
ttaacagcgaccatggccgaatattattacaccttggcagcaatgctcccacactctctc
gcttatcaaaatgcgatcagaagttatgtggaggaaggagatagctacttaaaactgata
aaactttatgccccaaacctaaatatgagcgagcaaatcaatcttaatacgggcatccag
caaggagccatttcattgacatggagttatgtcgctgtactgcgagctattggagcacga
gaaaaagtgacagtacattag

DBGET integrated database retrieval system