KEGG   Legionella lansingensis: 44548918_02215
Entry
44548918_02215    CDS       T05543                                 

Definition
(GenBank) stearoyl-CoA-9-desaturase
  KO
K00507  stearoyl-CoA desaturase (Delta-9 desaturase) [EC:1.14.19.1]
Organism
llg  Legionella lansingensis
Pathway
llg01040  Biosynthesis of unsaturated fatty acids
llg01100  Metabolic pathways
llg01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:llg00001]
 09100 Metabolism
  09103 Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    44548918_02215
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:llg01004]
    44548918_02215
Enzymes [BR:llg01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     44548918_02215
Lipid biosynthesis proteins [BR:llg01004]
 Desaturase
  First
   44548918_02215
SSDB
Motif
Pfam: FA_desaturase DDE_Tnp_ISL3
Other DBs
NCBI-ProteinID: SNV53757
LinkDB
Position
1:2408155..2409357
AA seq 400 aa
MIFGILNLTLWGYILATLVLTQVTIASVTLYLHRYQAHRALNLHPIVSHFFRFWIWLTTG
MVTKVWVAIHRKHHAMTDVEGDPHSPHIFSIKKVFWQVPELYREAAKDKDMIDKYSHGAP
NDWIERNLYSRYPNKGILLIFLINLLLFGLPGITIWAIQMIWIPLSAGVVNGVGHYWGYR
NFECSDKSTNVFPVGFLIGGEELHNNHHTYASSAKFSVKWWEFDLGWFYICCLSFLGLAK
VKKVPPTLARDDTKLYVDLNTIKAVISNRFQIMSDYYKRVTVPILKNEKRNHIKNKKEWY
LFKGAKRLLRQETTKANSHLQVLLNHFEQLQLVYNYRKSLQQIWLKKASSQKELIESLSQ
WCKKAEESGLDVLHQFSLRLKSYVLIDTDGSSVKMLKKCK
NT seq 1203 nt   +upstreamnt  +downstreamnt
atgatttttggtattttaaacctaacactttggggatatattttagcaacccttgttcta
actcaagtcaccattgcttcagtcactctttatttgcatcgctatcaagcccaccgtgct
ttaaacttgcatccaatagtgagtcatttctttcgattctggatttggttaacaaccggt
atggtgaccaaagtatgggttgctatccatcgtaaacatcatgcaatgacagatgttgaa
ggggatccacatagcccccacatctttagtataaaaaaggtcttttggcaggtccctgaa
ttgtatcgcgaagcagcaaaagataaagatatgattgacaagtattctcatggcgctcca
aatgattggattgaacgtaatctgtattctcgttaccctaacaagggtatacttcttata
tttctaattaatttgctactgtttggcctgcctggaattactatttgggcaatacaaatg
atttggatcccgctatcagcaggtgtagtgaatggcgtgggtcattattggggatatcgc
aattttgaatgctctgataagtcaaccaatgtatttcccgtgggctttctaataggtggg
gaagagcttcataataatcatcatacatacgcttcttctgctaaattttctgtgaaatgg
tgggaattcgatttgggctggttttatatatgttgtctatcctttttaggacttgctaag
gtaaaaaaagtacctcccacattagccagagacgataccaaactatatgttgatttaaat
actataaaagccgtcattagtaatcgttttcaaattatgtccgattactacaaaagggta
actgttcccattttgaaaaatgaaaaacgcaaccatattaaaaataaaaaagaatggtat
ttatttaagggtgctaaacgtctattacgccaagaaaccacaaaagctaactctcatttg
caagtcttactaaatcattttgaacaattacagcttgtttataattatcgtaaatcattg
caacaaatttggttaaaaaaagcatcctctcaaaaggagttaattgagtctttaagccaa
tggtgtaaaaaagcggaagaatcaggcctagatgtattgcatcaattttctcttcggcta
aaaagctacgtcttaattgacacagatggctcatcagtgaaaatgctgaaaaaatgtaaa
tga

DBGET integrated database retrieval system