KEGG   Legionella lansingensis: 44548918_02448Help
Entry
44548918_02448    CDS       T05543                                 

Gene name
sdhA
Definition
(GenBank) succinate dehydrogenase flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
llg  Legionella lansingensis
Pathway
llg00020  Citrate cycle (TCA cycle)
llg00190  Oxidative phosphorylation
llg00650  Butanoate metabolism
llg01100  Metabolic pathways
llg01110  Biosynthesis of secondary metabolites
llg01120  Microbial metabolism in diverse environments
llg01130  Biosynthesis of antibiotics
llg01200  Carbon metabolism
llg05134  Legionellosis
Module
llg_M00009  Citrate cycle (TCA cycle, Krebs cycle)
llg_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
llg_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:llg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    44548918_02448 (sdhA)
   00650 Butanoate metabolism
    44548918_02448 (sdhA)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    44548918_02448 (sdhA)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05134 Legionellosis
    44548918_02448 (sdhA)
Enzymes [BR:llg01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     44548918_02448 (sdhA)
    1.3.5.4  fumarate reductase (quinol)
     44548918_02448 (sdhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 GIDA HI0933_like DAO Thi4 FAD_binding_3 Lycopene_cycl FAD_oxidored Pyr_redox_3 NAD_binding_8 AbiEi_4
Motif
Other DBs
NCBI-ProteinID: SNV55148
LinkDB All DBs
Position
1:complement(2645563..2647332)
Genome map
AA seq 589 aa AA seqDB search
MGIARNKFDAVIIGAGGAGMRAALQLANSGLRVALLSKVFPTRSHTVSAQGGITAALGNA
HEDDWRWHMYDTVKGADYIGDQDCIEYMCKTGPEAVYELEHMGLPFSRMDSGRIYQRQFG
GQSRNFGGEQAARTCAAADRTGHALLHTLYQQNLRAKTHVFSEWYALDFVKDAHGRIAGV
TALCIETGEIVFYQTRVCILATGGAGRIYQSTTNAHINTGDGFGMALRAGIPLQDMEMWQ
FHPTGIAGAGVLVTEGCRGEGGYLINKDGERFMERYAPRVKDLASRDVVARAMALEIRAG
KGFDPKGVDHVKLKLDHLGAEQIKLRLPGIRELSLKFAGVDPIVEPIPVVPTCHYTMGGI
PTNMHGQVLTKKDDSEHIVEGLYAVGECACVSVHGANRLGGNSLLDLVVFGRAAGLHVEE
LWQSNQLPEMPYVSDDDIDASLVRYYRWENSTEGDSPTALRNEMQRVMQEDFGVFRTGEV
MENGLHRLQALRERLAHAMLGDKSKVFNTERITALELDNLMATAYASAKSALTRTESRGA
HSREDYPKRDDANWIKHTLYFEAGDSIDFRPVNTSPKYVKTFEPKERVY
NT seq 1770 nt NT seq  +upstreamnt  +downstreamnt
atgggaattgcacgtaacaaatttgatgccgttattattggtgcaggtggagctggaatg
cgtgcagccctgcagctagctaattcaggattgagggtagccttattatcaaaagttttt
ccgacccgctcgcatactgtttcggcgcaaggaggtattactgctgctcttggtaatgct
cacgaagatgattggcgttggcatatgtatgacacggtaaagggagccgattatatcggt
gaccaagactgcatcgaatacatgtgtaaaacaggtcctgaagcggtatatgagcttgaa
catatggggttaccattttctcgcatggatagcggcaggatttatcagcgccaatttgga
ggacaatccagaaattttggaggggagcaggcggcgcgaacgtgtgctgcagcagataga
acaggacacgctttattgcataccctttatcagcaaaatctccgagctaaaacacacgtt
ttcagtgaatggtatgctcttgattttgtaaaagatgcgcatggcagaattgccggtgtt
actgcactatgtattgaaacaggcgaaattgttttttatcaaaccagagtttgtattcta
gccactggcggtgctggccgtatttatcaatcgaccactaacgcacatataaacactgga
gacggttttggaatggctttgcgcgcgggtatacctctgcaagatatggagatgtggcaa
ttccatcctactggtattgctggtgccggtgttttagtcactgaaggttgccgtggagaa
ggtggttatttaattaataaggatggggaacgctttatggagcgctatgctccacgagta
aaagatttggcttcccgggatgttgttgcacgcgctatggcacttgaaattcgcgcaggc
aagggttttgatccaaaaggggttgaccatgtgaagctaaaacttgatcatttgggtgct
gagcaaatcaagttacggttacctggtatccgggagttatcattaaaatttgctggtgtg
gacccaattgttgagcctattccggttgtgccaacgtgtcactacacgatgggtggtatc
ccaaccaatatgcatggacaagtccttaccaaaaaggatgattcagagcatattgttgaa
ggtctctatgctgtaggtgaatgtgcttgtgtttctgtacacggtgctaatcggttgggt
ggcaactctctactcgatttagtcgtctttggtcgtgctgcgggcttacacgtagaagaa
ttatggcaatcaaatcaactgccagagatgccttatgtaagcgatgatgatattgacgct
tctttggtgcgttattatcgttgggaaaattccactgaaggcgacagcccaactgctctt
cgtaatgaaatgcaacgtgtaatgcaagaagattttggtgtgtttcgtacaggtgaagtg
atggagaatggacttcatcgattacaggctctgcgtgagcgattggcacatgccatgctt
ggggataaaagcaaggtgtttaacaccgagagaattaccgctttggagcttgataattta
atggcaactgcctatgcatcggccaagtctgcactgacacgtactgaaagccgtggggca
catagtcgagaagattatccaaaacgtgatgatgccaattggattaagcatacgttgtat
tttgaagcaggtgatagcattgattttcgccccgtaaatacgtcacctaaatatgtgaag
acttttgagcctaaagaacgcgtttattag

DBGET integrated database retrieval system