KEGG   Legionella lansingensis: 44548918_02466Help
Entry
44548918_02466    CDS       T05543                                 

Definition
(GenBank) interaptin
  KO
K20478  golgin subfamily B member 1
Organism
llg  Legionella lansingensis
Brite
KEGG Orthology (KO) [BR:llg00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:llg04131]
    44548918_02466
Membrane trafficking [BR:llg04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Retrieval pathways
   Rab associated proteins
    44548918_02466
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ank_2
Motif
Other DBs
NCBI-ProteinID: SNV55327
LinkDB All DBs
Position
1:complement(2666515..2679414)
Genome map
AA seq 4299 aa AA seqDB search
MVYCKKFIAGINAINFSPESAKLIKGSLVSFALNELEQTMETLKGELRDLPKKINDNPIV
NEQLKKYRQKQEENLRQIDGQIDALKRQASEEDLRVEAVELDETFLREFAENFRNLRHLA
DTLSDAPTLIKEQQTRLYTEILFKLDPAEQENQLQSLSLSNIQDMIKQAIVIYDTQKDIQ
LRNQAQKLVQMGMYEIVRRECLSVSEAPSADYVGYQEMLRSLGSKLPSVGNSSVIDDLSQ
YRSAADKKSIADLLLDVENKLKINVDADWRNQSRIDAFIERKALFHHLRFGQEDRREYAK
KTQNNIARDLFWGRNIRDIELFTKGGVSDDVFAGLCQKLFLGKPSTFSDIVDAKLDSFDP
EVKRLGIVMAEAKVKFKDSKNKKPLKQLVKEIFEEKFLKPSVSINKDGTIVVNFYYFADE
ESIISRIGETALRWEPSSLLGIWVKQSQGKIKDLHGLQLTGKSLADIEKQLTRLKISEDL
PKEAREAYISQLNNIKDTFGSDAEVQSISDLKLDNNDEILLRKLLELRYIAPVTRVTDNL
TIREALRKLSTGDFEGALKVTDLEKAVNDAYINLAKVDQSTVKPHVRPIIQKSRTLTSSF
LERKAKLLALDHAFQAQSSEEKIAAITEIFLEEYFGMASTLGFSEREIRPRLESDIRGMA
TEVVRLLDRTQKGDPALTKEEQAAYFSALKQIAEQIHPLKISEVQFKIPYSHEPGQEILV
TDNKGNTYKVALKEGSFPYSLIKPPGESEVVFSYGGSRGVIAPFEGFDEAYLRGSAKKRR
FFTHSRLLGVGQYGSVREVESLLSGLNQVIKKGYVPDTEPTFTEASRSDLRTRPITARDD
PLYRIESDILQNLSRATKANEGTLTGSTQYWIQDDKPRRKGALFAKDSTPKQYQILTERA
KGETFADAANNTLNQYTKGEEAYHNPAKRLKKEGEGKKEFDITPLKNMVALSEAITTGAE
KFAQLGFAHNDLKPENFLFKQNPDGSYQVRFIDWATGGFEAVLPDSDKALSIIFGELFGK
DLKFEEKGNICFDNNGRFVKKEKGQIIYGVNPSLQILHGARNGTLPYISPKVLEKGSSVA
AGITDPSLDTKLESKQDYMDNWALTAMTFGICNRRAYFALVKGRAVSDYIVPGILVDDGK
TPLGLKIVNAQLFNDYFACRDRLTESSLQTDEPYTKPNAVMFIPGNQREGEPLHLYRRLE
ALKQELSEKLPEDKSSLEYQIIRDIDTILDTVYEAVSSGKGLTKKQLREQLDAASRCIKN
YEKLRDKDYQEALAKRDSLQTILNQHLIGGIKFTANDLLKRSSAGGSDLEVLCTYPANKE
QKEQAIAILDQAFDEGELEDKFIREKSPGRRLFMACIANKQSEILIKLLGKISAKNDEFV
NLVEKQGLLHYAAQEGMSDVFDVLVSALQKAGASNTKIFKLMISTYGPENKEREEAANIK
WATTCFHIAIRNNNKQQLNTILHFLPEGSDNDEVIKQALHLCAVFGNKELFNSIVKRYDE
LNPRNKLTAEKIMTMVFPPDDLSPYHLFIRDEATVDVIAWKELKENKELAKQFLGFPGVS
PALIAAERGNFKAIDLLVKLGKDALAEEEWYQFFTQTDGKGKNILNHILEQGQLDYLHDF
IEMVKEQGPDKGADILVSLLGNPRPLNPLNNFLRKETNITQQFAVAKELLDAICPKFSSN
NPKPQQARLVALLLNKDWLIAQAAIPTNHEALRLLLQNEALSIPYKKVLFERLHEASKIS
EEATEFYKDLLAEVAPAAPAKKEMDSKTRLEIAGVLKEVARQSSDLNAFFKELISQHEAE
KELGEQVSSLRDEVSRYRKEAEEVTLKLSEQQDIVRKVTSELQGTSKKLEVAENDSQRLK
EEIEKINSSYEIKLKELQSKADENVEKVERLEEEYRLGKQELQKKLLEKEEEALGLSKEL
DKQKALLSEGTKVARELGEELKQLRLKNDDLSQKLKEETTLRKEERARLEEGLREESAKT
SDAVKHVEQLSLQLKNVSEEHDELKKKATILESTNAELLEKVSSLEDEVSRYRKEAEEVT
LKLSEQQDIVRKVTSELQGTSKKLEVAENDSQRLKEEIEKINSSYEIKLKELQSKADENV
EKVERLEEEYRLGKQELQKKLLEKEEEALGLSKELDKQKALLSEGTKVARELGEELKQLR
LKNDDLSQKLKEETTLRKEERARLEEGLREESAKTSDAVKHVEQLSLQLKNVSEEHDELK
KKATILESTNAELLEKVSSLEDEVSRYRKEAEEVTLKLSEQQDIVRKVTSELQGTSKKLE
VAENDSQRLKEEIEKINSSYEIKLKELQSKADENVEKVERLEEEYRLGKQELQKKLLEKE
EEALGLSKELDKQKALLSEGTKVARELGEELKQLRLKNDDLSQKLKEETTLRKEERARLE
EGLREESAKTSDAVKHVEQLSLQLKNVSEEHDELKKKATILESTNAELLEKVSSLEDEVS
RYRKEAEEVTLKLSEQQDIVRKVTSELQGTSKKLEVAENDSQRLKEEIEKINSSYEIKLK
ELQSKADENVEKVERLEEEYRLGKQELQKKLLEKEEEALGLSKELDKQKALLSEGTKVAR
ELGEELKQLRLKNDDLSQKLKEETTLRKEERARLEEGLREESAKTSDAVKHVEQLSLQLK
NVSEEHDELKKKATILESTNAELLEKVSSLEDEVSRYRKEAEEVTLKLSEQQDIVRKVTS
ELQGTSKKLEVAENDSQRLKEEIEKINSSYEIKLKELQSKADENVEKVERLEEEYRLGKQ
ELQKKLLEKEEEALGLSKELDKQKALLSEGTKVARELGEELKQLRLKNDDLSQKLKEETT
LRKEERARLEEGLREESAKTSDAVKHVEQLSLQLKNVSEEHDELKKKATILESTNAELLE
KVSSLEDEVSRYRKEAEEVTLKLSEQQDIVRKVTSELQGTSKKLEVAENDSQRLKEEIEK
INSSYEIKLKELQSKADENVEKVERLEEEYRLGKQELQKKLLEKEEEALGLSKELDKQKA
LLSEGTKVARELGEELKQLRLKNDDLSQKLKEETTLRKEERARLEEGLREESAKTSDAVK
HVEQLSLQLKNVSEEHDELKKKATILESTNAELLEKVSSLEDEVSRYRKEAEEVTLKLSE
QQDIVRKVTSELQGTSKKLEVAENDSQRLKEEIEKINSSYEIKLKELQSKADENVEKVER
LEEEYRLGKQELQKKLLEKEEEALGLSKELDKQKALLSEGTKVARELGEELKQLRLKNDD
LSQKLKEETTLRKEERARLEEGLREESAKTSDAVKHVEQLSLQLKNVSEEHDELKKKATI
LESTNAELLEKVSSLEDEVSRYRKEAEEVTLKLSEQQDIVRKVTSELQGTSKKLEVAEND
SQRLKEEIEKINSSYEIKLKELQSKADENVEKVERLEEEYRLGKQELQKKLLEKEDEALG
LSKELDKQKALLSEGTKVARELGEELKQLRLKNDDLSQKLKEETTLRKEERARLEEGLRE
ESAKTSDAVKHVEQLSLQLKNVSEEHDELKKKATILESTNAELLEQVSSLRDEVKQYKVK
LEQTTRELEEQRQVAREASKKEKETGAELEDAKLLIERMRQEMEELRKQMELREVKHKED
LAHQKDELLQEKREALREQKEDLDRVREESLIRQKDDLLRQQKEALENQKEDLDRRHEEE
QREALERQREELQRQHIEELRETREQVATLTEELDTARRELREVREELDETQQELERVQQ
RHTVEMEELGNERDELEEERDRLQEQLRIRAEQAELLEDPQLLAQRQALVMLNAQIKISK
DIECLTGIRDARSNADLQQAGVDAKLVAALAANAFTSLGMAAQNRLAELGRIEGRKRIDL
LNPNRYKTTLARDLNDLKSIYQNLNGITSLSEEIRDELRFLANVSPLHWLNPGFQAAAKK
HSNEMAPHFQKLADGCDVILGYLKPLRNELEHQLRCIPADLSGVVDQAQVNAIERRRAVL
TRYLRRVEGQIALYEPLHKRLYGDPGATNQLMKEGILHTIKNADKYDVQFLSFTSNYEDH
PLAEREGHFQPGYVSTIAAPAAPPTGAAVHGATHATYQIVERVKPGEYREHLINVGDPLS
GSFIEERATTFQPDPDQEDPLQGYRPDLQLTVTQFPVSATPNDPLLVPARVKWALAFATQ
LLADLEKAPTKKEPVLLYGQNEEVLRYLWTALVVIGKKTPNMTFDHTAVKVVSTAFNPQN
ELERVFGFTGWRYQFAPNSCYETCFKNQAALVNLLEGIREASENKLGHQQEQAQIKTSVA
HVTRMFAPPAAPSKAKTAGETIVEKLRQETQRKGPRGEG
NT seq 12900 nt NT seq  +upstreamnt  +downstreamnt
atggtttattgtaagaaattcattgccggtattaacgcaatcaatttttcccctgaatca
gcgaaacttattaaaggttccttggtttcctttgctttgaacgaactagaacagacaatg
gagactttaaaaggagagctaagggatctacctaaaaaaatcaatgataatcccatcgtc
aatgagcaactaaaaaaatacaggcaaaagcaagaagaaaatctccgacaaattgatggg
caaattgatgcgcttaaacggcaggcttcagaggaagatttgcgcgtggaggcagttgaa
cttgatgaaacgtttcttcgtgagtttgctgaaaatttccgtaatcttcgtcatttagcc
gacacactctctgatgcccctacccttatcaaagaacaacaaacacgcttatacacagaa
atcctttttaaactcgacccggctgagcaggaaaaccaattacagtccttatcgcttagt
aatatccaagatatgatcaagcaagcgatagtcatctatgatacgcaaaaggatattcaa
cttcgtaatcaagcccaaaagctcgtgcaaatgggtatgtatgaaattgttcgtcgtgaa
tgtctaagcgtgagtgaagctccatctgccgactatgtgggttatcaggagatgcttcgt
tctctggggtcaaagcttcctagtgtaggcaattcatctgtcatcgatgatttgagtcaa
tataggtcagcagccgataaaaaatcgattgctgatttattacttgatgttgagaacaaa
ttaaaaattaatgtggatgctgattggagaaatcagtctcggattgatgcttttatagaa
agaaaggctcttttccatcatttgagatttggtcaagaagaccgtcgggagtatgcgaag
aaaacgcaaaacaatatagcacgagatttattttggggaaggaacattcgtgatattgag
ctttttactaaaggcggtgtgtctgatgacgttttcgcaggcctttgtcaaaagctattt
ttgggaaagccatccacattttccgatatagtagatgcaaagttagatagctttgatccc
gaggtaaagcgtttaggcatcgtaatggctgaggctaaggttaaatttaaagactctaag
aataaaaaacccctaaaacaattggtcaaggaaatatttgaagaaaaatttttaaagccc
agcgtaagtattaataaagatggcaccattgttgtaaacttctattatttcgctgatgaa
gaaagtattatatcgagaattggtgaaacggcccttaggtgggagccgtcgagtctactg
ggtatatgggttaaacaaagtcaaggcaaaattaaggatcttcatggacttcagcttact
ggaaaatctctagctgatattgaaaaacagcttacgaggctcaaaatctcagaagatctg
cctaaagaggctcgtgaagcttatatatcccaactaaacaacattaaggatactttcgga
tcagacgctgaagtacaatcaataagcgatcttaaattagataataacgatgaaatttta
ttacgcaaattactcgaattacgctacatagctccagtcacaagggtaaccgataatctg
acgatccgcgaggccttgcgaaaattgagcacgggggattttgagggagctttaaaggtt
actgatttagaaaaagcagtcaatgatgcctatatcaatttagcaaaagttgatcaaagt
accgtcaagccccatgtgcgacctattattcaaaaatcaagaaccttaacctcatccttc
cttgaaagaaaagcaaaattgcttgccttagatcacgctttccaggctcaaagcagcgag
gaaaaaattgcagcaatcaccgaaatctttttggaagagtattttgggatggcttctacg
cttggattctccgaaagagagattcgtcctcgtttagagagtgatatccgcggtatggca
acagaagttgtccgcttgcttgatcgcactcaaaagggcgaccccgcattaactaaagaa
gaacaagctgcttatttttccgctcttaagcagattgccgagcagatacatcctcttaaa
ataagtgaagtgcaatttaagatcccctattctcatgaacctgggcaagagatccttgtt
actgacaataaaggaaatacatataaagttgccttgaaagaaggtagttttccttattcg
ctaatcaaaccacctggagaaagtgaggtcgtgttttcttatggtggtagtcgcggagtt
atcgcccctttcgagggttttgatgaggcttatcttcgcggaagtgcgaaaaaacgtcgc
ttttttacccattctcgtttattgggggtagggcaatatggctcagtcagggaagtggag
agtttattatccggtttaaaccaggtaataaaaaaaggctacgtccccgataccgaacca
acttttacagaagcaagccgaagcgatctgagaacgcgaccaatcactgctcgtgatgat
cctttataccgtattgaaagtgatattttgcaaaatctttcacgagccacaaaagcaaat
gaaggtactctcactggcagtacgcaatattggattcaagacgataaaccaaggcgtaaa
ggggctctgtttgcaaaagatagtacgcccaagcaatatcaaattctaacggaacgggct
aagggtgaaacctttgccgatgcagccaataacactttaaatcaatacaccaaaggcgag
gaagcctatcacaatcctgccaaacgattaaaaaaagagggagagggaaagaaagagttt
gatattactcctttgaaaaatatggttgctttatcagaagcgattactacgggggcggaa
aagtttgcacaattaggttttgctcacaatgatcttaagccggagaattttttattcaaa
caaaaccccgatggcagttaccaggttagatttattgactgggcaacgggtggttttgaa
gcagtacttccggatagtgataaagcattgtcaataatctttggtgagttattcggtaag
gatcttaaatttgaagaaaaagggaatatttgtttcgacaataatggtcgctttgtaaaa
aaagagaaaggacaaatcatttatggtgtaaacccttctctacaaattcttcacggtgca
cgcaacggtacgttgccttatataagtcccaaggttttagaaaaagggtcctctgtagca
gctggtattactgatccgagtttagatacgaagcttgagagcaagcaagactatatggat
aattgggcacttactgccatgacctttggtatttgtaaccgtcgggcttatttcgctctc
gttaaaggaagagcggtttctgattatattgttcccggtattctcgtcgacgatggaaag
acgcctttaggcttaaaaattgttaatgctcagttatttaatgactattttgcctgtcgt
gatcggctcactgagagctctttacaaacggatgagccttatactaagcccaatgcagta
atgtttattcctggtaatcaacgcgaaggggaaccattacacctttatcgtcgtctggaa
gcattaaaacaggaattaagcgagaagctcccagaagataagagtagtcttgagtatcaa
atcatccgggacattgataccatcctggatactgtttatgaagctgtttcttctggcaaa
gggcttacaaagaaacagctaagagagcagttggatgctgcttcgcgctgcattaaaaat
tacgagaaactacgcgataaagattaccaagaagccctggcaaaacgtgatagcctgcaa
actattcttaaccagcatctgataggtggaatcaaattcacggctaatgatttgctaaaa
agaagtagtgctggtggtagcgatttggaagtcttgtgtacttatcccgccaataaagaa
caaaaagaacaggccattgctattttagatcaagccttcgacgaaggggagttggaagat
aaattcattagagaaaaatctcctggtcgccgtctttttatggcatgtattgcgaacaag
caatcagagatcctcatcaaactcttaggaaaaataagcgcgaagaatgatgagtttgtt
aatctcgtagaaaaacaaggattattgcattatgcagctcaagagggcatgtctgatgtt
tttgatgttctggttagtgctttacaaaaagctggagcaagtaatacaaaaattttcaaa
ttaatgatctccacgtatggcccagaaaacaaagagcgcgaagaagctgccaatatcaaa
tgggcaaccacttgtttccatatcgccattcgcaacaacaataaacagcaattaaatact
attctgcactttctaccagaaggatcagataatgatgaagtgattaagcaggcattgcac
ctctgtgcggtgttcggtaataaggagttatttaacagtattgttaagcgctacgatgaa
cttaatcctcggaacaaattgaccgcggaaaaaatcatgaccatggtttttcccccagat
gatctttctccttatcatctctttattcgcgatgaagcgacagtagatgtaatcgcctgg
aaggaactaaaggaaaacaaagagcttgcaaaacaattcttaggattccctggcgtatct
cctgctctcattgccgctgaaaggggaaattttaaagcaattgatctcttggttaagtta
ggaaaagacgctcttgctgaagaggagtggtatcaattctttacacaaacggatggcaag
ggcaagaacatacttaaccatatccttgagcagggacaactcgattatctgcatgatttt
attgaaatggtcaaggagcaaggcccagataaaggtgcggatatattggtgagtttgttg
gggaacccacgtccgctaaatcctctaaataattttttacgcaaagaaaccaatattacc
caacaatttgcggtggccaaagagctacttgatgcaatttgtcctaagttttcttctaat
aatcccaaaccacagcaagcacgattagtagctctgctgcttaacaaggactggctaatc
gcacaagccgcaatccccactaatcatgaagccctacgtctgctgttacaaaacgaagct
ttatccatcccctacaaaaaagtccttttcgagagattgcatgaggcgtccaaaatatct
gaggaggccacagaattctataaagatctactcgcagaagtggctcctgcggctcctgct
aaaaaggaaatggatagcaagacaagacttgagatcgctggtgtattgaaagaagttgca
cgtcagagcagtgatctgaatgcgtttttcaaggaattaataagtcaacatgaagctgag
aaagagcttggtgagcaagtttcatcactacgggatgaggttagccgttataggaaagag
gctgaagaagtcaccctcaaattgtcagagcaacaagacattgttaggaaggttacatct
gaattgcaagggacgagcaagaaattagaggttgcggagaacgattcgcaacgtctgaaa
gaagagattgaaaagattaactcctcttatgaaatcaagttaaaggagcttcaatcaaaa
gcagatgagaacgtagaaaaggtagagcgattagaagaagagtatcgcttaggcaaacaa
gagctgcaaaagaagctgttagaaaaagaggaggaggcactgggattgtctaaggaatta
gacaagcaaaaagcactgttaagtgaagggacgaaggtagctagggaattaggagaagag
cttaagcagttgaggctaaagaatgatgatttaagtcaaaaacttaaagaagagacgaca
ttaaggaaagaagagagggcgcgtcttgaggaaggtctaagggaagagagcgctaaaacg
agtgatgctgtaaaacatgttgagcagttatcgctgcaactaaagaatgtttcagaagag
catgatgaacttaagaagaaagcaacgattcttgagagcacgaatgcggagttgttagag
aaagtttcgtcactagaggatgaggttagccgttataggaaagaggctgaagaagtcact
ctcaaattgtcagagcaacaagacattgttaggaaggttacatctgaattgcaagggacg
agcaagaaattagaggttgcggagaacgattcgcaacgtctgaaagaagagattgaaaag
attaactcctcttatgaaatcaagttaaaggagcttcaatcaaaagcagatgagaacgta
gaaaaggtagagcgattagaagaagagtatcgcttaggcaaacaagagctgcaaaagaag
ctgttagaaaaagaggaggaggcactgggattgtctaaggaattagacaagcaaaaagca
ctgttaagtgaagggacgaaggtagctagggaattaggagaagagcttaagcagttgagg
ctaaagaatgatgatttaagtcaaaaacttaaagaagagacgacattaaggaaagaagag
agagcgcgtcttgaggaaggtctaagggaagagagcgctaaaacgagtgatgctgtaaaa
catgttgagcagttatcgctgcaactaaagaatgtttcagaagagcatgatgaacttaag
aagaaagcaacgattcttgagagcacgaatgcggagttgttagagaaagtttcgtcacta
gaggatgaggttagccgttataggaaagaggctgaagaagtcaccctcaaattgtcagag
caacaagacattgttaggaaggttacatctgaattgcaagggacgagcaagaaattagag
gttgcggagaacgattcgcaacgtctgaaagaagagattgaaaagattaactcctcttat
gaaatcaagttaaaggagcttcaatcaaaagcagatgagaacgtagaaaaggtagagcga
ttagaagaagagtatcgcttaggcaaacaagagctgcaaaagaagctgttagaaaaagag
gaggaggcactgggattgtctaaggaattagacaagcaaaaagcactgttaagtgaaggg
acgaaggtagctagggaattaggagaagagcttaagcagttgaggctaaagaatgatgat
ttaagtcaaaaacttaaagaagagacgacattaaggaaagaagagagggcgcgtcttgag
gaaggtctaagggaagagagcgctaaaacgagtgatgctgtaaaacatgttgagcagtta
tcgctgcaactaaagaatgtttcagaagagcatgatgaacttaagaagaaagcaacgatt
cttgagagcacgaatgcggagttgttagagaaagtttcgtcactagaggatgaggttagc
cgttataggaaagaggctgaagaagtcactctcaaattgtcagagcaacaagacattgtt
aggaaggttacatctgaattgcaagggacgagcaagaaattagaggttgcggagaacgat
tcgcaacgtctgaaagaagagattgaaaagattaactcctcttatgaaatcaagttaaag
gagcttcaatcaaaagcagatgagaacgtagaaaaggtagagcgattagaagaagagtat
cgcttaggcaaacaagagctgcaaaagaagctgttagaaaaagaggaggaggcactggga
ttgtctaaggaattagacaagcaaaaagcactgttaagtgaagggacgaaggtagctagg
gaattaggagaagagcttaagcagttgaggctaaagaatgatgatttaagtcaaaaactt
aaagaagagacgacattaaggaaagaagagagggcgcgtcttgaggaaggtctaagggaa
gagagcgctaaaacgagtgatgctgtaaaacatgttgagcagttatcgctgcaactaaag
aatgtttcagaagagcatgatgaacttaagaagaaagcaacgattcttgagagcacgaat
gcggagttgttagagaaagtttcgtcactagaggatgaggttagccgttataggaaagag
gctgaagaagtcactctcaaattgtcagagcaacaagacattgttaggaaggttacatct
gaattgcaagggacgagcaagaaattagaggttgcggagaacgattcgcaacgtctgaaa
gaagagattgaaaagattaactcctcttatgaaatcaagttaaaggagcttcaatcaaaa
gcagatgagaacgtagaaaaggtagagcgattagaagaagagtatcgcttaggcaaacaa
gagctgcaaaagaagctgttagaaaaagaggaggaggcactgggattgtctaaggaatta
gacaagcaaaaagcactgttaagtgaagggacgaaggtagctagggaattaggagaagag
cttaagcagttgaggctaaagaatgatgatttaagtcaaaaacttaaagaagagacgaca
ttaaggaaagaagagagggcgcgtcttgaggaaggtctaagggaagagagcgctaaaacg
agtgatgctgtaaaacatgttgagcagttatcgctgcaactaaagaatgtttcagaagag
catgatgaacttaagaagaaagcaacgattcttgagagcacgaatgcggagttgttagag
aaagtttcgtcactagaggatgaggttagccgttataggaaagaggctgaagaagtcact
ctcaaattgtcagagcaacaagacattgttaggaaggttacatctgaattgcaagggacg
agcaagaaattagaggttgcggagaacgattcgcaacgtctgaaagaagagattgaaaag
attaactcctcttatgaaatcaagttaaaggagcttcaatcaaaagcagatgagaacgta
gaaaaggtagagcgattagaagaagagtatcgcttaggcaaacaagagctgcaaaagaag
ctgttagaaaaagaggaggaggcactgggattgtctaaggaattagacaagcaaaaagca
ctgttaagtgaagggacgaaggtagctagggaattaggagaagagcttaagcagttgagg
ctaaagaatgatgatttaagtcaaaaacttaaagaagagacgacattaaggaaagaagag
agggcgcgtcttgaggaaggtctaagggaagagagcgctaaaacgagtgatgctgtaaaa
catgttgagcagttatcgctgcaactaaagaatgtttcagaagagcatgatgaacttaag
aagaaagcaacgattcttgagagcacgaatgcggagttgttagagaaagtttcatcacta
gaggatgaggttagccgttataggaaagaggctgaagaagtcaccctcaaattgtcagag
caacaagacattgttaggaaggttacatctgaattgcaagggacgagcaagaaattagag
gttgcggagaacgattcgcaacgtctgaaagaagagattgaaaagattaactcctcttat
gaaatcaagttaaaggagcttcaatcaaaagcagatgagaacgtagaaaaggtagagcga
ttagaagaagagtatcgcttaggcaaacaagagctgcaaaagaagctgttagaaaaagag
gaggaggcactgggattgtctaaggaattagacaagcaaaaagcactgttaagtgaaggg
acgaaggtagctagggaattaggagaagagcttaagcagttgaggctaaagaatgatgat
ttaagtcaaaaacttaaagaagagacgacattaaggaaagaagagagggcgcgtcttgag
gaaggtctaagggaagagagcgctaaaacgagtgatgctgtaaaacatgttgagcagtta
tcgctgcaactaaagaatgtttcagaagagcatgatgaacttaagaagaaagcaacgatt
cttgagagcacgaatgcggagttgttagagaaagtttcatcactagaggatgaggttagc
cgttataggaaagaggctgaagaagtcaccctcaaattgtcagagcaacaagacattgtt
aggaaggttacatctgaattgcaagggacgagcaagaaattagaggttgcggagaacgat
tcgcaacgtctgaaagaagagattgaaaagattaactcctcttatgaaatcaagttaaag
gagcttcaatcaaaagcagatgagaacgtagaaaaggtagagcgattagaagaagagtat
cgcttaggcaaacaagagctgcaaaagaagctgttagaaaaagaggacgaggcactggga
ttgtctaaggaattagacaagcaaaaagcactgttaagtgaagggacgaaggtagctagg
gaattaggagaagagcttaagcagttgaggctaaagaatgatgatttaagtcaaaaactt
aaagaagagacgacattaaggaaagaagagagggcgcgtcttgaggaaggtctaagggaa
gagagcgctaaaacgagtgatgctgtaaaacatgttgagcagttatcgctgcaactaaag
aatgtttcagaagagcatgatgaacttaagaagaaagcaacgattcttgagagcacgaat
gcggagttgttagaacaagtttcatcactacgggatgaagtaaagcaatacaaagttaag
cttgagcagacaaccagagagctggaggaacaacgccaagtagcgagagaagcctcaaaa
aaagaaaaagaaactggtgcagaattagaagatgcgaaattgcttatagagcgtatgcgc
caggagatggaagagctacggaagcaaatggagctgcgagaggttaaacacaaagaagat
cttgcacatcaaaaagatgagctgttacaagaaaagcgagaggctttaagagaacaaaaa
gaagatctagaccgggtacgcgaagaatcattaattcgccagaaagatgatttgttacga
caacagaaagaagccttggaaaatcaaaaagaagatctggatagaaggcatgaggaagaa
caaagagaggccctagaaagacaaagagaagaactacaaagacagcatattgaggaattg
cgtgaaactagagagcaagtagccacccttactgaggagctagatactgctagacgagaa
ctacgtgaggtcagagaggaactagatgaaactcaacaagaactggaacgagttcaacaa
agacatactgtggaaatggaggagcttggaaatgaaagagatgagctcgaagaagaacga
gacaggctgcaggagcaattgcgtattcgcgcagaacaagccgagcttcttgaggatcca
cagctattggctcagcgacaagcattggtgatgctaaatgcccagattaagattagcaag
gatatcgaatgcttgacgggaataagagatgccagaagcaatgctgaccttcaacaagca
ggggtagatgctaaattagttgctgctttggcagcaaatgcctttacctcactcggtatg
gctgcacagaatcggttagctgagttgggacgaatagaagggcgtaaaagaatcgatctt
ttaaatcctaatagatataaaactactttagcaagggatctcaatgacttgaaatcaatc
tatcagaacttgaatggtatcacttcccttagcgaggaaattcgagatgaactgcgattt
ttagctaatgtttcgcctcttcactggttgaatcccggctttcaagcagcagctaaaaag
cactcgaatgagatggctcctcacttccaaaaattagcggatggttgtgatgtgatcctt
ggttatttaaaaccactgcgcaatgaattagaacaccaattgcgttgcattcctgctgat
ttaagcggtgtcgttgatcaagctcaagtaaacgcgattgaaagacgccgtgcagttttg
acccgttacttacgaagagtggaaggccaaatagcgctttacgaaccattacataagcgg
ttgtatggtgatcccggtgctacaaatcaattaatgaaagaaggtattctccatactatt
aagaatgctgataaatatgatgttcagttcctctcgtttacaagtaactacgaagatcat
cctttagctgaacgagagggtcattttcaacctggctatgtatccactatagcagcacca
gcagcaccaccaacaggagcagcagtccatggtgctactcacgcaacctaccaaatcgtt
gaaagggtcaagccaggtgagtatcgtgaacatctgattaatgtgggtgacccattgagt
ggctcatttattgaagaacgagctaccacgtttcagcctgatccggatcaggaagaccct
ttgcaaggatataggccggatctgcagcttacagtaactcagtttcctgtgtcagccact
cctaatgatcctctgctagttcctgcacgtgtaaaatgggcacttgctttcgctacccag
ctattagctgatttggaaaaagcaccgactaagaaagagccagtgcttttgtatggtcag
aatgaggaagtgctcaggtatttatggacggcattggttgtcattggcaaaaaaacaccc
aacatgacttttgatcatactgctgttaaagtggtgtccacggctttcaatcctcaaaat
gaacttgaacgtgtattcggctttacgggctggagatatcagtttgcgccgaattcctgc
tatgaaacctgctttaagaaccaagctgcactggttaatctattggaaggtatcagggaa
gcaagcgaaaataaattaggacatcaacaagaacaggcacagatcaaaacttcagtagcg
catgtgactcggatgtttgctcctcctgccgctcctagcaaagccaaaacagcaggggaa
acgattgttgagaagttaagacaggaaactcagcgcaaaggaccgaggggtgagggttaa

DBGET integrated database retrieval system