KEGG   Lactococcus lactis subsp. cremoris UC509.9: uc509_0153Help
Entry
uc509_0153        CDS       T02415                                 

Gene name
aspC
Definition
(GenBank) aminotransferase AlaT
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
lli  Lactococcus lactis subsp. cremoris UC509.9
Pathway
lli00220  Arginine biosynthesis
lli00250  Alanine, aspartate and glutamate metabolism
lli00290  Valine, leucine and isoleucine biosynthesis
lli01100  Metabolic pathways
lli01110  Biosynthesis of secondary metabolites
lli01130  Biosynthesis of antibiotics
lli01210  2-Oxocarboxylic acid metabolism
lli01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:lli00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    uc509_0153 (aspC)
   00290 Valine, leucine and isoleucine biosynthesis
    uc509_0153 (aspC)
   00220 Arginine biosynthesis
    uc509_0153 (aspC)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:lli01007]
    uc509_0153 (aspC)
Enzymes [BR:lli01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     uc509_0153 (aspC)
    2.6.1.66  valine---pyruvate transaminase
     uc509_0153 (aspC)
Amino acid related enzymes [BR:lli01007]
 Aminotransferase (transaminase)
  Class I
   uc509_0153 (aspC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_5 Beta_elim_lyase
Motif
Other DBs
NCBI-ProteinID: AFW90849
LinkDB All DBs
Position
157914..159128
Genome map
AA seq 404 aa AA seqDB search
MRKFEKSHKLDNVSYDIRGPVLDEAQRMRANGEKILRLNTGNPAEFGFLAPDEVISDLIQ
HAVDSEGYSDSKGIFSARKAIMQYCQLKGFPNLDINDIFTGNGVSELIVMAMQGLLDTGD
EVLIPMPDYPLWTASVSLAGGTAVHYLCDEQAGWFPDIDDIRSKITSNTKAIVLINPNNP
TGALYSKDLLLEIVQVARENNLIIFSDEIYDRLVMDGAVHVPIASLAPDLFVVTMNGLSK
SHRIAGFRVGWMVLSGEKSHVKGYIEGLNMLASMRLCSNVLAQSVVQTSLGGTQSVDKLL
LPGGRVYEQREFIYKAINDIPGLSAVKPQAAFYIFPKIDREMYKIDNDEQFVLDFLKQEK
ILLVHGRGFNWKDPDHFRIVYLPRVDELAEIQEKMERFLWQYRK
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgagaaagtttgaaaaatcgcataaacttgataatgtcagctatgatattcgtggtcca
gtgcttgatgaagcacagcgtatgcgagccaatggtgaaaaaattcttcggttgaataca
ggaaatccagcggaatttggttttcttgccccagacgaagtgattagcgatttgattcag
catgctgtggatagcgaaggttattcagattctaaaggtattttctcggctcgtaaggcg
attatgcaatactgtcaacttaaaggcttccctaatctggatatcaatgacattttcact
ggtaacggtgtttctgaattaatcgttatggctatgcaaggccttttggatacgggtgat
gaggttttgatccctatgcctgattatccgctctggacggcttctgtcagcttagctggg
ggaacagcggttcactatctctgcgatgaacaagctggatggtttccggatattgatgat
attcgctcaaaaattactagtaatactaaagccattgttttaattaatcctaataatcca
acgggtgcgctgtattctaaagatttattacttgaaattgtccaagtggctagagaaaat
aatttaattatcttttcggatgagatttatgaccgtttggtcatggacggcgctgttcat
gttccgattgccagcttagcacctgacctttttgtggtcacaatgaatggactttccaag
tcacatcgtattgctggatttcgtgtgggctggatggttctgtcaggtgagaaatcgcat
gtcaaaggctatatcgaaggcttgaacatgctcgcttcaatgagactttgttcaaatgtt
ttagctcagtctgttgtgcaaacctcacttggtgggactcaatctgttgataagctgctt
ttgccagggggacgagtttatgaacaaagagaattcatttataaagccattaatgatatt
ccaggattgtctgccgtgaagccacaagctgctttctatattttccctaaaattgacaga
gaaatgtataaaattgataatgatgaacaatttgttttagactttttaaaacaggaaaag
atacttcttgttcatggtcgaggattcaattggaaagatcctgatcattttcggattgtc
tatctgcctcgtgtagatgaactggcggaaatacaggaaaaaatggaacgctttttatgg
cagtatcgtaaataa

DBGET integrated database retrieval system