KEGG   Lactococcus lactis subsp. cremoris UC509.9: uc509_0355Help
Entry
uc509_0355        CDS       T02415                                 

Gene name
ahpF
Definition
(GenBank) Peroxiredoxin reductase
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
lli  Lactococcus lactis subsp. cremoris UC509.9
Brite
KEGG Orthology (KO) [BR:lli00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    uc509_0355 (ahpF)
Enzymes [BR:lli01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     uc509_0355 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA FAD_oxidored Thioredoxin_3 FAD_binding_2 HI0933_like DAO Thi4 FAD_binding_3 AlaDh_PNT_C K_oxygenase NAD_binding_8 Lycopene_cycl Glutaredoxin
Motif
Other DBs
NCBI-ProteinID: AFW91022
LinkDB All DBs
Position
348264..349790
Genome map
AA seq 508 aa AA seqDB search
MILDENLRSQLLPYMDLLENPIILKVDANDSENGQKINEFTDELASLSDLISKEKTNLNH
KPAFSIEREGVSGVAFSGLPLGHELNSLVLALVQVSGRPPRIEQELIEQIKAIKTSLHFD
TYVSLTCHNCPDVVQALNTMTILNPNISHTMIEGGMFQAEVEAKGIMAVPAVFKNAEEFH
SGRATLEELLEKITGPESSDSFAEKEPYDVLVVGGGPAGASAAIYAARKGIRTGLIAERF
GGQPLETLGIENLIGTPYIEGVQLGRQLEEHVKKYPVDLMNLQKAVKLEKKDLIEVSLEN
GATLKSKAVILSTGARWRDLGIPGEQRFKNKGVAYCPHCDGPLFSGKDVAVIGGGNSGIE
AAIDLAGLVNHVTVLEFLPELKADKILQKKLASLTNVTVLTNVETKEILGDEQVTGLNYQ
VRGSKETIHLELAGVFVLIGLVPNTQWLEGTIDLTDRHEIVTDKVGATNIPGVFAAGDCT
DTVYKQIIVSMGSGATASLGAFDYLIRN
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
atgattttagatgaaaatctgcgttctcagttactgccgtatatggatttattagaaaat
ccaattattttaaaagtggacgcaaacgatagtgaaaatggacaaaaaataaatgaattt
acagatgaactggcaagtttatcagacttgatttcaaaagagaaaacaaatctgaatcat
aaaccggctttttcaattgaaagagaaggtgtttcaggggttgctttttcaggtcttcct
ttgggtcatgagttaaattcattggttttggcccttgtgcaagtgagtggtcgaccacca
cgtattgaacaagaattaattgaacaaattaaggctattaaaacttcacttcattttgat
acttatgtcagtttaacttgtcataattgtccagatgtggttcaagctttaaatacaatg
accattctcaaccctaacattagtcataccatgattgagggaggcatgttccaagcagaa
gtagaagcaaaaggaattatggctgttcctgctgtctttaaaaatgccgaagaatttcat
agtggacgagcaactcttgaagaattgttggaaaaaattacaggtccagaaagttcggat
agtttcgcagaaaaagaaccttatgatgttttggtagtaggaggggggccagctggtgcg
agtgcagctatttatgcggcacgtaagggaatcaggacaggattgattgccgagcgcttt
ggaggccaacctttagaaactttagggattgaaaatctgattggaacaccctatatagag
ggtgttcagcttgggcgtcagcttgaagaacacgtaaaaaaatatccagtagatttgatg
aatctgcaaaaagcagttaaacttgagaaaaaagatttaattgaagtaagtcttgaaaat
ggtgcaaccttgaagagtaaagctgttattctctcaactggcgctcgttggcgggattta
ggaatcccaggagaacaacgctttaagaataaaggagtggcttattgtcctcattgtgat
ggtccgcttttctctggtaaagatgtggcagttattggtggaggaaattcagggattgaa
gcagcgatagacttagctggtttggtcaaccatgtcactgttcttgaatttttaccagaa
cttaaagcagataaaatcttacaaaaaaaacttgctagtctaactaatgttactgttttg
accaatgtggaaactaaagagattttaggagatgagcaagtcacggggttgaattatcaa
gttcgaggctctaaagaaacgattcatttagagcttgccggtgtctttgttttgattggt
ttagttcccaatactcagtggttggaagggacaattgatttgacagatcgtcatgaaatt
gtgactgataaggttggagcaacaaatattccgggtgtctttgcagcaggagattgcaca
gatactgtttataaacaaattattgtgtcaatgggaagtggagcgactgcttccttaggt
gcctttgattatttgataagaaattaa

DBGET integrated database retrieval system