KEGG   Lactococcus lactis subsp. cremoris UC509.9: uc509_0594Help
Entry
uc509_0594        CDS       T02415                                 

Gene name
tdk
Definition
(GenBank) thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
lli  Lactococcus lactis subsp. cremoris UC509.9
Pathway
lli00240  Pyrimidine metabolism
lli01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lli00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    uc509_0594 (tdk)
Enzymes [BR:lli01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     uc509_0594 (tdk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK KdpD AAA_30 AAA_22 Fmp27_WPPW
Motif
Other DBs
NCBI-ProteinID: AFW91209
LinkDB All DBs
Position
583354..583923
Genome map
AA seq 189 aa AA seqDB search
MAQLYFKYGTMNSGKSIEILKVAHNYEEQGKPVLLMTSSLDTRAGVGTVASRIGMKAEAI
AIDDKMSVFDYVNSLSAKPFCVLIDEAQFLNKKHVYDFARVVDELNVPVMAFGLKNDFRN
ELFEGSKYLLLLADKIEEIKTICWYCSKKATMVIRTIDGKPVYEGEQLQIGGNETYIPVC
RKHYFKPEI
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atggcgcaattatatttcaaatatggtacgatgaattcaggaaagtcaattgagattttg
aaagtggctcataattatgaggaacagggcaagccagttctcttgatgacatcaagccta
gatacccgtgctggtgttggaacagttgcgagtcggattggtatgaaagcagaagctatc
gcaattgatgataaaatgtctgtttttgattatgtgaatagcctgtctgctaaacctttt
tgtgtcttaattgatgaggcacaatttttaaataaaaaacatgtctatgattttgcgcga
gtagtcgacgaattgaatgttccagtcatggcctttggtttgaaaaatgattttcgtaat
gaactttttgaagggtctaaatacctgcttttacttgctgataaaattgaagaaattaaa
acaatttgctggtattgtagtaaaaaagcgacgatggttattcgaacaattgacggtaaa
ccagtctatgaaggtgaacagttacagattggtggaaatgaaacttatattccggtttgc
cggaagcattattttaaaccagaaatctag

DBGET integrated database retrieval system