KEGG   Lactococcus lactis subsp. cremoris UC509.9: uc509_1378Help
Entry
uc509_1378        CDS       T02415                                 

Gene name
glpD
Definition
(GenBank) Alpha-glycerophosphate oxidase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
lli  Lactococcus lactis subsp. cremoris UC509.9
Pathway
lli00564  Glycerophospholipid metabolism
lli01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:lli00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    uc509_1378 (glpD)
Enzymes [BR:lli01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     uc509_1378 (glpD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored GIDA Pyr_redox_3 Pyr_redox_2 HI0933_like Pyr_redox NAD_binding_8 FAD_binding_3 Lycopene_cycl
Motif
Other DBs
NCBI-ProteinID: AFW91879
LinkDB All DBs
Position
1370520..1372097
Genome map
AA seq 525 aa AA seqDB search
MSISRQKNIEYLKANPDDWDFIIIGGGATGLGVAVDAASRGYKTVLVEQSDFAKSTSSRS
TKLVHGGVRYLAQGDVSLVRESLHERGRLARNGPHLVKNQKFIIANYKAWEQPFYSIGMK
MYDALAGKLNIGKSKIYSKKKVAEAIPQIKHEHLVGGVMYYDGQFDDARMAINLMQTATE
QGALLVNYVKVTELVKTNSKVSSVKLHDELSGESFELHGKSIINATGIFVDQIMSMDTKE
HKPSVRPSQGVHLIVDGSFLGGQDAIMVPKTSDGRVLFCVPWHNKVILGTTDTPLTEFVL
EPRPLEEEIDFILETAGQYLEKKPERKDVLTAYAGLRPLAAPKEGDGKKTKEISRSHKLF
TSESGLVTITGGKWTTYRQMAEETVDLAIKTSKLPEKKCITRTLKIHGAKETTERERQNW
LYVYGSDKGKILALQNEDSSLALPLHPKYEFTGSEVIWAVREEMAQTLDDVLARRIRALF
LDARIAKEMAPKVAQLMAKEMGKDEAWEKEQVESFLALADGYILK
NT seq 1578 nt NT seq  +upstreamnt  +downstreamnt
atgtctatctctcgtcaaaaaaatattgaatatttaaaagcaaatcccgatgattgggac
ttcattattatcggtggtggagcaaccggacttggagttgcggttgatgccgcatcacgc
ggttataaaacagttctagttgaacaaagtgactttgcaaaatcaacttcaagccgctcg
acaaaacttgttcacggtggcgttcgctaccttgctcaaggagatgtcagccttgttcgt
gaatcattacatgaaagaggtcgccttgctcgcaacggtccccatcttgtaaaaaatcaa
aaatttatcattgccaattacaaagcttgggagcaaccattttatagcatcggaatgaaa
atgtatgatgctttggcaggtaaattgaatattggaaaatcaaaaatttattctaagaaa
aaagttgctgaagcaattcctcaaatcaaacatgaacatctcgtcggaggagtcatgtat
tatgacggacaattcgatgatgctagaatggctatcaaccttatgcaaactgccactgaa
caaggtgcgctactagttaattatgtcaaagtgactgagcttgttaaaacgaactcaaaa
gtatcttctgttaaacttcatgatgaactttctggcgaatcatttgaacttcacggaaaa
tccatcatcaacgctacaggaatctttgttgaccaaattatgtcaatggataccaaagaa
cacaagccctctgttcgtccttcacaaggcgtccacctcattgttgacggctcatttctc
ggtggtcaagatgccattatggttccaaaaacttctgacggtcgtgtcttgttctgtgtc
ccttggcacaataaagtaatcttaggaacgacagatacacctcttacagaattcgtttta
gaacctcgaccccttgaagaagaaattgatttcatcttagaaactgctggtcaatattta
gaaaagaaacccgaacgtaaagatgttttaactgcttatgctggtttacgtccacttgcc
gctcccaaagaaggtgatggcaaaaaaacgaaagaaatttcaagaagtcataaactcttc
acctctgaatcaggactggtcacaattactgggggaaaatggacaacttatcgccaaatg
gccgaagaaactgttgatttagcaatcaaaacctctaaacttcctgaaaaaaaatgtatc
accagaacattgaaaatacatggggccaaagaaacaactgaaagagaacgtcaaaactgg
ctctatgtttacggttctgataaaggaaagattttagctctccaaaatgaagactcttct
ttagccttacctcttcacccaaaatacgaatttacaggttctgaagtcatctgggctgtc
cgtgaagaaatggctcaaactctagatgatgttctcgctcgtcggattcgtgcacttttc
cttgatgcaagaattgccaaagaaatggctcccaaagtcgcccaactgatggcgaaagaa
atgggtaaagatgaagcatgggaaaaagaacaagttgagagcttccttgctttagctgat
ggttatattttaaaataa

DBGET integrated database retrieval system