KEGG   Lactococcus lactis subsp. cremoris UC509.9: uc509_1689Help
Entry
uc509_1689        CDS       T02415                                 

Gene name
pheA
Definition
(GenBank) prephenate dehydratase
  KO
K04518  prephenate dehydratase [EC:4.2.1.51]
Organism
lli  Lactococcus lactis subsp. cremoris UC509.9
Pathway
lli00400  Phenylalanine, tyrosine and tryptophan biosynthesis
lli01100  Metabolic pathways
lli01110  Biosynthesis of secondary metabolites
lli01130  Biosynthesis of antibiotics
lli01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:lli00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    uc509_1689 (pheA)
Enzymes [BR:lli01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.51  prephenate dehydratase
     uc509_1689 (pheA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PDT ACT Patched
Motif
Other DBs
NCBI-ProteinID: AFW92151
LinkDB All DBs
Position
complement(1686832..1687671)
Genome map
AA seq 279 aa AA seqDB search
MKFAYLGPRGSFCSVVAEAAFKSEELYSYATILDVIEAYNEGECDFALVPIENSTEGTVN
MSIDKIFHDSNAKVVAEFVLPISQNLLAVSKEQKIEHIYSHPQALAQTRVYLRKFYPQAQ
VEITESTSAAAEFVKNNPNLPAAAVANSFAAKMYDLEFIAENIQDLAGNSTRFWLLGKEK
QSFDLNQTKDKVTLALTLPDNLPGALHKAISVFAWRDIDMTKIESRPLRTHLGQYFFIID
LENNATNSLKIPYALEELAGLGVNVRLLGNYSVYSLGEV
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atgaaatttgcatatttaggtccacgaggttctttttgctcagtcgtagccgaagcagct
tttaaatctgaggagttgtactcttatgcaactattttggatgtcattgaagcttataat
gaaggcgaatgtgattttgcactagttcctattgaaaattcaactgaaggaacggtcaat
atgagcattgataaaatttttcatgattcaaatgccaaggttgtggccgagtttgttctt
ccaatttctcaaaatttattggcagtttctaaagaacaaaaaattgagcatatttactct
catcctcaagctttggctcaaacgagagtttatttgagaaaattttatcctcaggcgcag
gtggaaattactgagtccacttcggcagcggctgagtttgtgaaaaataatccgaacttg
cccgcagcagcggtggcaaattcttttgcagctaaaatgtatgatttggaatttattgct
gaaaatattcaagatttggcggggaattcgactcgattctggttactaggaaaagaaaag
caatcctttgatttaaatcaaacaaaggataaggtgactttggctttgacgctacctgac
aatttgccaggagcattgcacaaagcaatttctgtttttgcttggcgtgatattgacatg
actaaaattgagtcacgtcctttaaggacacatttgggacagtacttttttattattgat
ttagaaaataatgcaacgaacagtttaaagattccttatgctcttgaagaattggcaggt
ttgggagtaaatgttcgattgttaggaaattattcagtatattcattaggtgaggtgtaa

DBGET integrated database retrieval system