KEGG   Lactococcus lactis AI06: LG36_0139Help
Entry
LG36_0139         CDS       T03480                                 

Gene name
aspC
Definition
(GenBank) Aspartate aminotransferase
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
llj  Lactococcus lactis AI06
Pathway
llj00220  Arginine biosynthesis
llj00250  Alanine, aspartate and glutamate metabolism
llj00290  Valine, leucine and isoleucine biosynthesis
llj01100  Metabolic pathways
llj01110  Biosynthesis of secondary metabolites
llj01130  Biosynthesis of antibiotics
llj01210  2-Oxocarboxylic acid metabolism
llj01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:llj00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    LG36_0139 (aspC)
   00290 Valine, leucine and isoleucine biosynthesis
    LG36_0139 (aspC)
   00220 Arginine biosynthesis
    LG36_0139 (aspC)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:llj01007]
    LG36_0139 (aspC)
Enzymes [BR:llj01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     LG36_0139 (aspC)
    2.6.1.66  valine---pyruvate transaminase
     LG36_0139 (aspC)
Amino acid related enzymes [BR:llj01007]
 Aminotransferase (transaminase)
  Class I
   LG36_0139 (aspC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_5 Beta_elim_lyase
Motif
Other DBs
NCBI-ProteinID: AIS02739
UniProt: A0A2A9ISD4
LinkDB All DBs
Position
156147..157361
Genome map
AA seq 404 aa AA seqDB search
MRKFEKSHKLDNVSYDIRGPVLDEAQRMRANGEKILRLNTGNPAEFGFLAPDEVISDLIQ
HAVDSEGYSDSKGIFSARKAIMQYCQLKGFPNLDINDIFTGNGVSELIVMAMQGLLDTGD
EVLIPMPDYPLWTASVSLAGGTAVHYLCDEQAGWFPDIDDIRSKITSNTKAIVLINPNNP
TGALYSKDLLLEIVQVARENNLIIFSDEIYDRLVMDGAVHVPIASLAPDLFVVTMNGLSK
SHRIAGFRVGWMVLSGEKSHVKGYIEGLNMLASMRLCSNVLAQSVVQTSLGGTQSVDKLL
LPGGRVYEQREFIYKAINDIPGLSAVKPQAAFYIFPKIDREMYKIDNDEQFVLDFLKQEK
ILLVHGRGFNWEEPDHFRIVYLPRVDELAEIQEKMERFLWQYRK
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaatttgaaaaatcgcataaacttgataatgtcagctatgatattcggggtcca
gtattggatgaagcacaaagaatgcgagcgaatggtgaaaaaattcttcgattgaataca
ggaaatccagctgaatttggctttcttgctcctgatgaagtcattagtgacttgattcaa
catgctgtggatagcgaaggatattcagattctaaaggaattttctcggctcgtaaagcg
attatgcagtactgtcagctcaaaggttttcctaatcttgatatcaatgatattttcaca
ggtaatggggtttctgaattgattgttatggccatgcagggacttttggacacaggggat
gaggttttgattcctatgcctgattatccactttggacggcttctgtcagcttagctgga
ggaacagctgttcattacctctgtgatgaacaggccggttggttccccgacattgatgat
attcgctcaaaaatcacaagtaatacaaaagctattgttttgattaatcctaataatcca
acgggtgcgctgtattctaaagatttattacttgaaattgttcaagtggctagagaaaat
aatttaattattttctcagacgaaatttatgaccgattggttatggatggagcagttcat
gttccgattgctagcttggcaccagatctttttgtggtcacaatgaatggactctcaaaa
tcacaccgcattgcaggattccgtgtggggtggatggttctgtcaggtgaaaaatcgcat
gtcaagggttatattgaaggtttgaatatgctggcttcaatgcgactttgttccaatgtt
ttagctcaatcagtcgtacaaacttcacttggtggcactcaatcggttgataaattgctg
ttgccgggtggacgagtttatgaacaaagagagttcatttataaagccatcaatgatatt
ccaggattatctgcggtcaaacctcaagcagctttctatattttccctaaaattgataga
gaaatgtataaaattgataatgatgaacaatttgtcttggactttttgaagcaggaaaaa
atcctgcttgttcatggtcgaggatttaattgggaagagccagaccatttccgaattgtt
tatctgcctcgtgtggatgaattagcggaaatacaagaaaaaatggaacgtttcctttgg
caatatcgtaaataa

DBGET integrated database retrieval system