KEGG   Lactococcus lactis AI06: LG36_0341Help
Entry
LG36_0341         CDS       T03480                                 

Gene name
ahpF
Definition
(GenBank) Peroxiredoxin reductase
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
llj  Lactococcus lactis AI06
Brite
KEGG Orthology (KO) [BR:llj00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    LG36_0341 (ahpF)
Enzymes [BR:llj01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     LG36_0341 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_oxidored HI0933_like FAD_binding_2 Thi4 DAO FAD_binding_3 AlaDh_PNT_C Glutaredoxin NAD_binding_8 K_oxygenase Lycopene_cycl
Motif
Other DBs
NCBI-ProteinID: AIS02941
LinkDB All DBs
Position
357656..359185
Genome map
AA seq 509 aa AA seqDB search
MILDETLRAQLMPYMDLLENPIILKVDADLESENGKKIAEFTDELASLSEMISKETGKLN
RKTAFSIEREGVSGVLFSGLPLGHELNSLVLALVQVSGRPPRIEQELVERIQAIQNPLRF
ETYVSLTCHNCPDVVQALNTMSILNPNISHTMIEGGMFQEEVEAKGIMAVPTVFKNGEEF
HNGRASLEELLEKITGPESSEAFSDKEPYDILVVGGGPAGASAAIYAARKGIRTGLIAER
FGGQPLETLGIENLIGTPYVEGVQLGRQLEEHVKKYPVDLMNLQKAVKLEKKDLIEVSLE
NGALLKSKSVIISTGARWRDLGIPGEQEFKTKGVAYCPHCDGPLFAGKDVAVIGGGNSGI
EAAIDLAGLVRHVTVLEFLPELKADKILQEKLATLNNVTVLTNVETKEILGDDKVRGLNY
QVRGSKEIVQLELAGVFVLIGLVPNTQWLEGTIDLSARGEILTDKVGATNLPGVFAAGDC
TDSVYKQIIISMGTGATASLGAFDYLIRN
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
atgattttagatgaaactcttcgtgctcagttgatgccttatatggatttgttggaaaat
ccaattattttaaaagttgatgcagatttagagagcgaaaatgggaaaaaaatagcagaa
tttacagatgaacttgcaagtttgtctgaaatgatttcaaaagaaacaggaaaactcaac
cgaaaaacagctttttctattgaaagagaaggtgtttctggagtccttttttcagggcta
ccattaggtcatgagttgaattcattggtcttggcgcttgtccaagtaagtggacgccct
ccacggattgaacaagaattagttgagcgaattcaagcgattcaaaatccacttcgcttt
gaaacctatgtgagtttaacttgtcataactgtccagatgttgtccaagcattaaacaca
atgagtattctcaaccccaatattagtcacacaatgattgagggaggaatgttccaagaa
gaagtggaagcaaaagggattatggcggttccaactgttttcaaaaatggtgaagaattt
cataatggacgagctagtcttgaagaattactagaaaaaattactggtccagagagttct
gaagctttttctgataaagaaccttatgatattttagttgttggtggaggccctgctggc
gcaagtgcagctatttatgctgcgcgtaaagggattcggacaggtttaatcgctgaacgc
tttggcggtcaaccactagaaactttaggaattgaaaatctcattggaacgccttatgtt
gaaggggttcaacttggtcgtcagctcgaagaacatgtgaaaaaataccctgtcgatttg
atgaacttgcaaaaagcagttaagctagagaaaaaagacttgattgaggtgagtcttgaa
aatggggcacttctaaaaagtaagtcagttattatttcaacgggcgctcgttggcgagat
ttgggaattccaggagagcaagaatttaaaaccaaaggagtcgcttattgtccacattgt
gatggtcctttgtttgcaggaaaagatgtagcggttatcggtggcggaaattcaggaatc
gaagcagctattgatttagcgggtttggttagacatgttactgttctagaatttttacct
gaacttaaagcagacaaaattttacaagaaaaacttgcgaccctaaataatgttactgtt
ctcaccaatgtggaaacaaaagaaattttaggagatgacaaggttaggggcttgaattat
caagttcgtggctctaaagaaattgttcaattagagcttgctggtgtctttgttttaatt
ggtttagttccgaatacccagtggttggagggaacaattgacttatccgcacgtggagaa
attttgactgataaagttggagcaacaaatcttccgggtgtttttgcagcgggagattgt
acggatagtgtttataagcaaattattatttcaatggggactggggcgaccgcttctcta
ggagcttttgattatttgataaggaactaa

DBGET integrated database retrieval system