KEGG   Lactococcus lactis AI06: LG36_0994Help
Entry
LG36_0994         CDS       T03480                                 

Definition
(GenBank) holin
Organism
llj  Lactococcus lactis AI06
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Holin_SPP1
Motif
Other DBs
NCBI-ProteinID: AIS03594
UniProt: A0A2A9IK74
LinkDB All DBs
Position
1078295..1078582
Genome map
AA seq 95 aa AA seqDB search
MKTIDKGTLTRTVLLWLAIINQILTALGINPLPLDDNTISTVITTVFALWAWWKNNDFTH
AAKKGTELTKSLKNGDSVQVVKASDSDHEFTEGGE
NT seq 288 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacaatcgacaaaggaacactcacacgtacagttttgctttggttagctatcatt
aaccaaattctaacagcattgggtattaatccattgcctcttgatgataatactatcagc
acagttattacgacagtttttgcactttgggcatggtggaagaacaacgacttcactcat
gcagcaaaaaaaggaactgaacttactaaaagtttaaaaaatggagatagtgttcaagta
gttaaggcatctgattctgaccatgaattcacagaaggaggagaataa

DBGET integrated database retrieval system