KEGG   Lactococcus lactis AI06: LG36_1111Help
Entry
LG36_1111         CDS       T03480                                 

Gene name
gadA
Definition
(GenBank) Glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
llj  Lactococcus lactis AI06
Pathway
llj00250  Alanine, aspartate and glutamate metabolism
llj00430  Taurine and hypotaurine metabolism
llj00650  Butanoate metabolism
llj01100  Metabolic pathways
llj01110  Biosynthesis of secondary metabolites
llj01120  Microbial metabolism in diverse environments
llj02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:llj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    LG36_1111 (gadA)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    LG36_1111 (gadA)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    LG36_1111 (gadA)
   00430 Taurine and hypotaurine metabolism
    LG36_1111 (gadA)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    LG36_1111 (gadA)
Enzymes [BR:llj01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     LG36_1111 (gadA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5
Motif
Other DBs
NCBI-ProteinID: AIS03708
UniProt: A0A2A9I6J0
LinkDB All DBs
Position
1211378..1212778
Genome map
AA seq 466 aa AA seqDB search
MLYGKENRDEAEFLEPIFGSESEQVDLPKYKLAQKSIEPRVAYQLVQDEMLDEGNARLNL
ATFCQTYMEPEAVKLMSQTLEKNAIDKSEYPRTTEIENRCVNMIADLWNASEKEKFMGTS
TIGSSEACMLGGMAMKFSWRKRAEKLGLDINAKKPNLVISSGYQVCWEKFCVYWDIEMRE
VPMDKEHMSINLDKVMDYVDEYTIGVVGIMGITYTGRYDDIKALDNLIEEYNKQTDYKVY
IHVDAASGGLYAPFVEPELEWDFRLKNVISINTSGHKYGLVYPGVGWVLWRDKKYLPEEL
IFKVSYLGGELPTMAINFSHSASQLIGQYYNFVRYGFDGYKAIHERTHKVAMFLAKEIEK
TGMFEIMNDGSQLPIVCYKLKEDSNRGWNLYDLADRLLMKGWQVPAYPLPKNLENEIIQR
LVIRADFGMNMAFNYVQDMQEAIEALNKAHILYHEEPENKTYGFTH
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atgttatacggaaaagaaaatcgtgatgaagcagagttcttggaaccaatttttggttca
gaaagtgaacaagtggatttgcctaaatataaattagctcaaaaatcaattgagcctcga
gtggcctatcagttagttcaagatgaaatgttagatgaagggaatgctcgtttaaattta
gccacattctgtcaaacttatatggaacctgaagcagtcaaactaatgagtcagaccttg
gagaaaaatgcgattgataaatcggaatatccaagaacaactgaaattgaaaaccgttgt
gtcaacatgatcgctgacctttggaatgcgagtgaaaaagaaaaatttatggggacttca
acaattggttcttcagaagcttgtatgcttggtggaatggccatgaagttttcttggcgc
aagcgagcagaaaaattgggattagatattaatgcgaaaaagccaaacttagttatttca
tctggttatcaagtttgctgggaaaaattctgtgtttattgggatattgaaatgcgagaa
gtgccaatggataaagaacatatgtcaatcaatttggacaaggtgatggattatgttgat
gagtacacgattggtgtagttggtattatggggattacttatactggtcgttatgatgat
atcaaagctttggataatttaattgaagaatataataaacagacagattacaaagtttat
attcacgtagatgctgcttcaggagggctttatgctccctttgttgagccagaacttgag
tgggacttccgtttgaaaaatgtcatttcaatcaatacttcaggtcataaatatggttta
gtttatcctggtgtaggttgggttttgtggcgtgacaaaaaatatttaccagaagaatta
atttttaaagtaagttatcttggaggagaactaccaacgatggccattaatttttctcac
agtgcctctcaattaattggtcaatattataattttgtacgttatggatttgatgggtat
aaagctatccatgagagaacgcataaagtagccatgtttttagcaaaagaaattgaaaaa
actgggatgtttgaaattatgaacgatgggtcacaattgccaattgtctgctataaatta
aaagaagattcaaatcggggttggaatctttatgatttggcggaccgtttattaatgaag
ggatggcaagtgcctgcttatccacttcctaagaatttggaaaatgaaatcattcaacgt
ttagtgattcgagcagattttgggatgaatatggcatttaactatgttcaagatatgcaa
gaagcaattgaggctttaaataaggctcatattctataccatgaggaacctgaaaataaa
acatatggttttactcactaa

DBGET integrated database retrieval system