KEGG   Lactococcus lactis AI06: LG36_1226Help
Entry
LG36_1226         CDS       T03480                                 

Gene name
folP
Definition
(GenBank) Dihydropteroate synthase
  KO
K00796  dihydropteroate synthase [EC:2.5.1.15]
Organism
llj  Lactococcus lactis AI06
Pathway
llj00790  Folate biosynthesis
llj01100  Metabolic pathways
Module
llj_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:llj00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    LG36_1226 (folP)
Enzymes [BR:llj01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     LG36_1226 (folP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_bind
Motif
Other DBs
NCBI-ProteinID: AIS03823
LinkDB All DBs
Position
complement(1348252..1349325)
Genome map
AA seq 357 aa AA seqDB search
MKILELNQESFSLKNIILKFDELNQNELISLQKKLYRNGSLTRLTPDSLLVVLTIDDLAK
LINLFENDEDKKMLEVIYKRHQIIWSGKNFNFDLTRKSIVYSIVNVTPDSFYDGNPDNLS
LSHILKRVETDLENGASVLELGGKSSKPGYDDISPEEEWNRLKEPILELKKNFPKAIFAV
DTDEAYVMERVLDAGVDIINDIDGFDTGNKLKVLEKYQPAVVAMNNGRAGFSYAENVYEE
LPLFFENKKEELLQLGLKTEQIVIDPGVGFFNGDSGSDSLERVKTTEILSRIGLPLMIAI
SRKSFMGKLFNAQGEERLFSSLILEAQMVADGGRILRVHDVKETKRLLDAIEIYKEF
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatcttagaacttaatcaagaatctttttctcttaaaaatattatcctaaaattt
gatgagttaaatcaaaatgaattgatttctcttcaaaaaaaactttatcgaaatggtagt
ttgacaagactgactccagactccttgttagtagttttaacaattgatgacttagcaaaa
ttgattaatctttttgaaaatgatgaagataaaaaaatgcttgaagtgatttataaacgt
catcaaatcatttggtcaggtaaaaatttcaattttgatttaactagaaagtcaattgtc
tattcaatcgtcaatgttacaccagactctttttatgatggaaatccagataatttaagc
ctctctcatattttaaaaagagtagaaactgatttagaaaatggagcttctgttcttgag
ttgggagggaaatcgtcgaaaccaggatatgacgatattagcccagaagaggaatggaac
agactgaaagaacctattcttgagttgaaaaaaaactttcctaaagcaatttttgctgtc
gatacggatgaagcttatgtcatggaacgagttttagacgctggggttgatattattaac
gatattgatggctttgatacaggtaataaattaaaagtgctagaaaagtatcaaccggct
gtagttgctatgaataatgggcgagctggttttagttatgctgagaatgtttatgaagaa
cttccattattttttgaaaataaaaaagaagagttacttcaacttggtttaaaaactgaa
caaatcgttattgatcctggagttggtttttttaatggagattcaggttcagatagtctc
gagcgggttaaaacaactgaaattttaagtagaataggtttacctcttatgattgcaatc
tctcgtaagtcatttatgggaaaactcttcaatgcccaaggagaagagcggcttttttca
agccttatcctagaagcgcaaatggttgctgacgggggacggattttgcgtgttcatgat
gttaaggagaccaaacgtttacttgatgcaattgaaatttataaggaattttaa

DBGET integrated database retrieval system